PRGDB00050069 (Pi-ta)

From PRG Wiki
Jump to: navigation, search
Pi-ta
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 158836930 (AB364489)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza rufipogon

Comment?

Oryza rufipogon Pi-ta gene, complete cds, strain: W0137.

DNA Sequence

ATGGCGCCGGCGGTCAGTGCATCGCAGGGTGTCATCATGCGGTCCCTGACGAGCAAGCTCGACTCGCTGCTGCTGCAGCCGCCGGAGCCGCCGCCGCCTGCGCAACCGTCGTCGCTGCGGAAGGGGGAGAGGAAGAAGATCCTCCTCCTCAGAGGCGATCTCCGACACCTGCTAGATGACTACTACCTCCTCGTGGAGCCGCCGTCAGACACCGCGCCACCGCCAGACTCGACGGTGGCGTGCTGGGCGAAGGAGGTTCGCGAGCTCTCCTACGACGTCGACGACTTCCTCGACGAGCTAACGACCCAGCTCCTCCACCACCGCGGCGGCGGCGATGGCAGTAGCACTGCTGGTGCCAAGAAGATGATCAGCAGCATGATCGCCCGGCTACGAGGGGAGCTTAACCGGAGGCGGTGGATCGCCGACGAGGTCACCCTGTTCAGGGCCCGCGTGAAGGAGGCGATTCGCCGCCACGAGAGCTACGATCTTGGCAGGCGCACCTCGAGCTCGAGGCCGAGAGAAGAAGACGACGACGACGATCGCGAGGACTCCGCCGGCAACGAACGCCGCCGGTTTCTGTCGCTGACGTTCGGGATGGACGACGCTGCTGTGCACGGCCAGCTCGTTGGTAGGGATATTTCGATGCAAAAGCTCGTCCGGTGGCTGGCCGACGGCGAGCCGAAGCTCAGGGTGGCTTCCGTTGTTGGATCCGGAGGTGTTGGCAAGACGACGCTGGCCACAGAATTCTATCGTCTGCATGGCCGGCGGTTGGATGCGCCGTTCGACTGCCGGGCTTTCGTGCGGACGCCCCGGAAGCCTGACATGACGAAGATCCTCACCGACATGCTGTCACAGCTGCGGCCACAACATCAGCATCAGTCTTCGGATGTTTGGGAGGTTGATCGACTCCTTGAAACTATCCGGACGCATTTGCAAGATAAAAAGTACTTCATCATAATTGAAGATTTATGGGCTTCATCAATGTGGGATATTGTTAGCCGTGGTTTGCCTGATAATAATAGTTGCAGTAGAATACTAATAACAACAGAAATTGAACCTGTAGCTTTGGCATGCTGTGGATATAACTCAGAGCACATTATTAAGATTGATCCACTGGGTGATGATGTCTCAAGTCAATTGTTTTTCAGTGGAGTTTTTGGCCAAGGAAATGAATTTCCGGGATATCTTACTGAAGTTTCTCATGACATAATAAAAAAATGTGGTGGCTTGCCACTAGCAATAACTATAACAGCCAGACATTTTAAAAGCCAGCTGTTAGATGGAATGCAGCAATGGAATCACATACAAAAATCATTGACTACTTCCAATTTGAAGAAAAATCCTACTTTGCAGGGGATGAGGCAAGTACTCAACCTTATTTACAATAATCTTCCTCGTTGTTTGAAAGCATGTCTGTTATACCTTAGCATCTACAGAGAGGACTACATAATTAGGAAGGCCAACTTGGTGAGGCAATGGATGGCTGAAGGTTTCATCAATTCCATAGAAAATAAAGTCATGGAAGAAGTTGCAGGGAACTATTTTGATGAACTTGTTGGTAGGGGCCTGGTCCAACCAGTAGATGTTAACTGCAAAAATGAGGTATTGTCATGTGTAGTGCACCACATGGTATTAAATTTCATCAGGTGTAAGTCAATAGAGGAGAATTTCAGCATTACATTGGATCATTCTCAGACGACAGTAAGACATTCTGACAAGGTTCGCCGACTCTCTCTTCACTTTAGCAATGCACATGATACAACACCACTAGCAGGTTTGAGACTCTCACAAGTTCGATCGATGGCATTTTTCGGACAAGTCAAGTGTATGCCTTCCATTGCAGATTATAGGCTTCTTCGAGTTCTGATTCTTTGTTTTTGGGCTGATCAAGAGAAAACAAGCTATGACCTCACAAGCATTTCTGAACTGATACAACTGAGATATCTGAAGATAACAGGTAATATCACAGTTAAACTTCCAGAGAAGATCCAAGGACTACAACACTTGCAGACACTGGAAGCAGATGCAAGAGCAACTGCTGTCCTATTGGATATTGTTCATACACAGTGTTTGTTGCACCTTCGTCTTGTACTACTTGATCTGCTCCCTCACTGTCACAGGTACATCTTCAACAGCATCCCCAAATGGACTGGAAAGCTCAACAATCTCTGCATTTTAAACATTGCAGTCATGCAAATTTCCCAGGATGACCTTGACACTCTCAAAGGACTGGGATCTCTCACTGCTCTTTCGCTGCTTGTTCGAACAGCGCCTGCACAAAGAATCGTCGCGGCGAATGAGGGGTTCGGGTCTCTCAAGTACTTCATGTTTGTCTGTACAGCACCATGCATGACTTTTGTGGAAGGAGCAATGCCGAGTGTGCAAAGGTTAAATCTAAGGTTCAATGCCAACGAGTTCAAGCAGTATGACTCTAAGGAGACAGGGTTTGAACACTTGGTCGCCCTTGCAGAGATCTCTGCAAGAATTGGGGGCACTGATGATGATGAATCAAACAAAACTGAAGTGGAGTCTGCCTTGAGGACTGCAATTCGCAAGCATCCGACGCCGAGCACTCTTATGGTTGATATACAATGGGTGGATTGGATCTTTGGTGCTGAAGGGAGAGACTTGGATGAAGATTTGGCACAACAAGATGATAACGGGTATGGATTTTTCATTCTATTCCCAGGTTACAACTTACAAGGATTATTGAGCTTCTTTCTTTCTCTGCTGTGGCTTCTATCTTTACCTTCTATGCATCTTCAACCTGACTTGATGATTGTTTGA



Domains

Domain Start-End Description Sequence

Seg: seg
20-39 seg

LDSLLLQPPEPPPPAQPSSL

Seg: seg
48-64 seg

LLLRGDLRHLLDDYYLL

HMMPanther: PTHR11017:SF126
57-624 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

LLDDYYLLVEPPSDTAPPPDSTVACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAKKMISSMIARLRGELNRRRWIADEVTLFRARVKEAIRRHESYDLGRRTSSSRPREEDDDDDREDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLRVASVVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKKYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVFGQGNEFPGYLTEVSHDIIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPRCLKACLLYLSIYREDYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQTTVRHSDKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLIL

HMMPanther: PTHR11017
57-624 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLDDYYLLVEPPSDTAPPPDSTVACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAKKMISSMIARLRGELNRRRWIADEVTLFRARVKEAIRRHESYDLGRRTSSSRPREEDDDDDREDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLRVASVVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKKYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVFGQGNEFPGYLTEVSHDIIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPRCLKACLLYLSIYREDYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQTTVRHSDKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLIL

Seg: seg
67-78 seg

PPSDTAPPPDST

Seg: seg
165-184 seg

RRTSSSRPREEDDDDDREDS

superfamily: SSF52540
185-444 P-loop containing nucleoside triphosphate hydrolases

AGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLRVASVVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKKYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVFGQGNEFPGYLTEVSHDIIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNL

HMMPfam: PF00931
IPR002182
214-501 NB-ARC,NBS
NB-ARC

SMQKLVRWLADGEPKLRVASVVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKKYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVFGQGNEFPGYLTEVSHDIIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPRCLKACLLYLSIYREDYIIRKANLVRQWMAEGFINS

Seg: seg
231-241 seg

VASVVGSGGVG

FPrintScan: PR00364
IPR000767
231-246 DISEASERSIST
Disease resistance protein

VASVVGSGGVGKTTLA

FPrintScan: PR00364
IPR000767
310-324 DISEASERSIST
Disease resistance protein

HLQDKKYFIIIEDLW

FPrintScan: PR00364
IPR000767
407-421 DISEASERSIST
Disease resistance protein

CGGLPLAITITARHF

superfamily: SSF52058
539-826 L domain-like,LRR

VVHHMVLNFIRCKSIEENFSITLDHSQTTVRHSDKVRRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLILCFWADQEKTSYDLTSISELIQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFNSIPKWTGKLNNLCILNIAVMQISQDDLDTLKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCTAPCMTFVEGAMPSVQRLNLRFNANEFKQYDSKETGFEHLVALAEIS

Gene3D: G3DSA:3.80.10.10
632-752 no description

KTSYDLTSISELIQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFNSIPKWTGKLNNLCILNIAVMQISQDDLDTLKGLGSLTALSL

Seg: seg
691-702 seg

LLHLRLVLLDLL

Seg: seg
903-916 seg

LLSFFLSLLWLLSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox