PRGDB00050087 (lectin receptor-like kinase Tg-20)

From PRG Wiki
Jump to: navigation, search
lectin receptor-like kinase Tg-20
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 150409462 (EF492527)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Musa acuminata

Comment?

Musa acuminata lectin receptor-like kinase Tg-20 gene, partial cds.

DNA Sequence

GGCGTCTACAAAGGCTTCCTGAATCGCTCGGGGAAGGAGGTCGCGGTGAAGAAGATCTCCAGCAAATCAAAACAGGGGAAGAAGGAGTACGCATCGGAGGTGAAGATCATCAGCCGGCTGAGACATCGAAACCTGGTGCAGTTGATCGGTTGGTGCCACGAGCGCGGCGAGTTCCTCCTCGTCTATGAGTTCCTCCCCAACGGAAGCCTCGACTACCACCTGTTCAACCGGAAGACCACCCTCCCGTGGGGGATCAGATACAACATCGCGCTCGGCCTGGCCTCGGCCCTGCTCTACCTCCACGAGGAGTGGGAGCAGTGCGTGGTGCACAGAGACGTCAAGTCCAGCAACGTGATGCTGGACTCCGGGTTCAACGCCAAGCTGGGGGACTTCGGCCTCGCGAGGCTGGTCGACCACCAGCTCGGCCAGCACGCGACTGGGCCGGCGGGGACGCTGGGCTACCTGGCGCCGGAGTGCTTCAACACAGGCAAGGCCAGCAAGGAGTCG


Protein sequences

Name Description Sequence
lectin receptor-like kinase Tg-20 lectin receptor-like kinase Tg-20 [Musa acuminata].

GVYKGFLNRSGKEVAVKKISSKSKQGKKEYASEVKIISRLRHRNLVQLIGWCHERGEFLLVYEFLPNGSLDYHLFNRKTTLPWGIRYNIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSGFNAKLGDFGLARLVDHQLGQHATGPAGTLGYLAPECFNTGKASKES

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-169 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GVYKGFLNRSGKEVAVKKISSKSKQGKKEYASEVKIISRLRHRNLVQLIGWCHERGEFLLVYEFLPNGSLDYHLFNRKTTLPWGIRYNIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSGFNAKLGDFGLARLVDHQLGQHATGPAGTLGYLAPECFNTGKASKES

HMMPanther: PTHR24420:SF438
2-169 PTHR24420:SF438,SUBFAMILY NOT NAMED

VYKGFLNRSGKEVAVKKISSKSKQGKKEYASEVKIISRLRHRNLVQLIGWCHERGEFLLVYEFLPNGSLDYHLFNRKTTLPWGIRYNIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSGFNAKLGDFGLARLVDHQLGQHATGPAGTLGYLAPECFNTGKASKES

HMMPfam: PF00069
IPR000719
2-164 Pkinase,Ser-thr
Protein kinase, catalytic domain

VYKGFLNRSGKEVAVKKISSKSKQGKKEYASEVKIISRLRHRNLVQLIGWCHERGEFLLVYEFLPNGSLDYHLFNRKTTLPWGIRYNIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSGFNAKLGDFGLARLVDHQLGQHATGPAGTLGYLAPECFNTGK

superfamily: SSF56112
IPR011009
2-169 Kinase_like
Protein kinase-like domain

VYKGFLNRSGKEVAVKKISSKSKQGKKEYASEVKIISRLRHRNLVQLIGWCHERGEFLLVYEFLPNGSLDYHLFNRKTTLPWGIRYNIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSGFNAKLGDFGLARLVDHQLGQHATGPAGTLGYLAPECFNTGKASKES

Gene3D: G3DSA:3.30.200.20
2-50 G3DSA:3.30.200.20

VYKGFLNRSGKEVAVKKISSKSKQGKKEYASEVKIISRLRHRNLVQLIG

HMMPanther: PTHR24420
2-169 PTHR24420,FAMILY NOT NAMED

VYKGFLNRSGKEVAVKKISSKSKQGKKEYASEVKIISRLRHRNLVQLIGWCHERGEFLLVYEFLPNGSLDYHLFNRKTTLPWGIRYNIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSGFNAKLGDFGLARLVDHQLGQHATGPAGTLGYLAPECFNTGKASKES

Gene3D: G3DSA:1.10.510.10
51-167 G3DSA:1.10.510.10

WCHERGEFLLVYEFLPNGSLDYHLFNRKTTLPWGIRYNIALGLASALLYLHEEWEQCVVHRDVKSSNVMLDSGFNAKLGDFGLARLVDHQLGQHATGPAGTLGYLAPECFNTGKASK

PatternScan: PS00108
IPR008271
108-120 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDVKSSNVML


List of References

Santy Peraza-Echeverria, Andrew James-Kay, Blondy Canto-Canché, Eduardo Castillo-Castro
Structural and phylogenetic analysis of Pto-type disease resistance gene candidates in banana.
Mol. Genet. Genomics: 2007, 278(4);443-53
PubMed:17587056 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox