PRGDB00050098 (CK1)

From PRG Wiki
Jump to: navigation, search
CK1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121501692 (EF101866)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Receptor-Like Kinase, Receptor-Like Kinase
Gene Species Beta vulgaris

Comment?

Beta vulgaris RNA-directed DNA polymerase gene, partial cds; and heat stress transcription factor HSF, NPR1 (NPR1), hypothetical protein, integrase, hypothetical protein, retrotransposon proteins, hypothetical proteins, polynuclyotidyl transferase, transp

DNA Sequence

ATGGAGCCTCGTGTTGGAAACAAGTATCGACTTGGTCGTAAGATCGGAAGTGGTTCATTTGGAGAGATCTATCTTGGAACTAACATTCAAACTAATGAAGAGGTGGCAATTAAGCTTGAAAATGTTAAGACAAAACATCCACAGTTGCTCTATGAGTCAAAGCTATACAGGATCCTGCAGGGAGGAACTGGAATTCCAAATGTGAGGTGGTTTGGCGTAGAGGGTGATTACAATGTTCTTGTTATGGATCTACTTGGGCCTAGCCTTGAAGATCTATTTAACTTCTGCAGCAGGAAATTTTCGTTGAAAACAGTTCTCATGCTTGCAGATCAGATGATTAACAGGATCGAGTTTGTTCATTCAAAATCCTTCTTGCATCGTGATATTAAGCCCGACAACTTCCTCATGGGCTTGGGTAGACGAGCAAATCAGGTCTACGTTATTGATTTTGGCTTAGCAAAGAAATACAGAGATACAACTACGCATCAGCATATCCCATATAGAGAAAATAAAAACTTGACGGGAACTGCAAGATATGCGAGTATGAACACTCACCTCGGAATAGAACAAAGCAGGAGGGATGATTTAGAATCTCTTGGATATGTGCTGATGTACTTCCTAAGAGGCAGCCTTCCTTGGCAGGGACTAAAGGCTGGGACCAAGAAACAAAAGTATGAGAAAATCAGTGAGAAAAAGGTCTCCACATCAATTGAGGCCCTATGTCGTGGTTATCCAACCGAGTTTGCATCATACTTCCATTACTGCCGCTCATTACGATTTGATGATAAACCTGACTATGCTTACCTGAAGAGAATTTATCGAGACCTCTTCATTCGAGAAGGTTTTCAATTCGACTACGTGTTTGACTGGACTATTCTGAAATATCAGCAATCACAATTAGCCGCTCCTCCTGCTCGTACGGGTGCTGGTGCTGGAACTAGTGCAGGAGTACCTACTCCGCCAGTTGCAAATCCTGAAAGGAAATTGGGTGAAGAAGAAGGCCGAGCAGGTGGTCTGTCTACTGGAGATGGTCTTCGACGAAGAATGTCAGGGTCACTTTTGAATTCTGGAAGTCTATTGAAGCAGAAGAGTCCTCTTGCAAATGATCCAACTGTAAGCAAAGATCCTACGTTGTCAAGCACAAATCTTACGGGACGGTCCAGTGGTTTTCTAAAGCGAGCTGCTATTCCCAGTAGCCGTGAAGCAGTTACAGGAGGGAATGAATCTGATCCTTCCCGTTCTCGTACAGCCGAGGCAAGCCCAAGCACAATGCAGAGGTTTTCAAGTGGGCAGAGAAGTTCTCCAGTTGGATCCTCAGATGCAAAGCAGCAATCCTCTGGTAGGATTACCAGCATTAAAAACTATGAGTCCACACTCAAGGGCATTGAGAGTCTGCATTTTGATGATGAAAGGGTCCATTAA


Protein sequences

Name Description Sequence
casein kinase casein kinase [Beta vulgaris].

MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVHSKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVSTSIEALCRGYPTEFASYFHYCRSLRFDDKPDYAYLKRIYRDLFIREGFQFDYVFDWTILKYQQSQLAAPPARTGAGAGTSAGVPTPPVANPERKLGEEEGRAGGLSTGDGLRRRMSGSLLNSGSLLKQKSPLANDPTVSKDPTLSSTNLTGRSSGFLKRAAIPSSREAVTGGNESDPSRSRTAEASPSTMQRFSSGQRSSPVGSSDAKQQSSGRITSIKNYESTLKGIESLHFDDERVH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11909:SF18
1-471 PTHR11909:SF18,CASEIN KINASE

MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVHSKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVSTSIEALCRGYPTEFASYFHYCRSLRFDDKPDYAYLKRIYRDLFIREGFQFDYVFDWTILKYQQSQLAAPPARTGAGAGTSAGVPTPPVANPERKLGEEEGRAGGLSTGDGLRRRMSGSLLNSGSLLKQKSPLANDPTVSKDPTLSSTNLTGRSSGFLKRAAIPSSREAVTGGNESDPSRSRTAEASPSTMQRFSSGQRSSPVGSSDAKQQSSGRITSIKNYESTLKGIESLHFDDER

HMMPanther: PTHR11909
1-471 PTHR11909,CASEIN KINASE-RELATED

MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVHSKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVSTSIEALCRGYPTEFASYFHYCRSLRFDDKPDYAYLKRIYRDLFIREGFQFDYVFDWTILKYQQSQLAAPPARTGAGAGTSAGVPTPPVANPERKLGEEEGRAGGLSTGDGLRRRMSGSLLNSGSLLKQKSPLANDPTVSKDPTLSSTNLTGRSSGFLKRAAIPSSREAVTGGNESDPSRSRTAEASPSTMQRFSSGQRSSPVGSSDAKQQSSGRITSIKNYESTLKGIESLHFDDER

Gene3D: G3DSA:3.30.200.20
2-79 G3DSA:3.30.200.20

EPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNV

superfamily: SSF56112
IPR011009
5-290 Kinase_like
Protein kinase-like domain

VGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVHSKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVSTSIEALCRGYPTEFASYFHYCRSLRFDDKPDYAYLKRIYRDLFIREGFQFDYVFDW

ProfileScan: PS50011
IPR000719
9-278 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVHSKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVSTSIEALCRGYPTEFASYFHYCRSLRFDDKPDYAYLKRIYRDLFI

HMMPfam: PF00069
IPR000719
9-243 Pkinase,Ser-thr
Protein kinase, catalytic domain

YRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVHSKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVSTSIEALCRG

PatternScan: PS00107
IPR017441
15-38 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGSFGEIYLGTNIQTNEEVAIK

Gene3D: G3DSA:1.10.510.10
80-273 G3DSA:1.10.510.10

LVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVHSKSFLHRDIKPDNFLMGLGRRANQVYVIDFGLAKKYRDTTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYEKISEKKVSTSIEALCRGYPTEFASYFHYCRSLRFDDKPDYAYLKRIY

PatternScan: PS00108
IPR008271
124-136 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FLHRDIKPDNFLM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox