PRGDB00050099 (CK1)

From PRG Wiki
Jump to: navigation, search
CK1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121501692 (EF101866)
Gene Class Unknown
Domain Type
Gene Species Beta vulgaris

Comment?

Beta vulgaris RNA-directed DNA polymerase gene, partial cds; and heat stress transcription factor HSF, NPR1 (NPR1), hypothetical protein, integrase, hypothetical protein, retrotransposon proteins, hypothetical proteins, polynuclyotidyl transferase, transp

DNA Sequence

TCCCTGTAACAGCCCTCCCTAGCTAGATTGGGGTGCTTGTATTGATTCAGCTAGATCTCTTACTGGCTATTGTGTGTTTCTTGGTATTTCTCTTATTTCTTGGAAATCCAAGAAACAAAAAGTGGTGTCCAAGAGCTCCACTGAAGCTGAATATAGGAGCATGAGTCATACTACTATCAGTTCCTTTGTGCTCCTAGAGTTCCTCACTTCTTAGCTGCACAACATGTTCTTGCAATCCAAGTATAATTATTCAATGTTCACTCTTAAATATGGTGATTCTTATACTGTTGTGGTGGCATATGTGGATGATTTATTGCTTGTCGGCACTCATCTTTCAAGTATTCAACATCTCAAAGAACAACCCCATGCTGCCTTCACTATTAAAGACCTAGGTCCCCTCAAATACTTTCTTGGTGTTGAGGTTACTAGAGATTCTACTGGAATTCTTCTCAATCAGAGAAAATGGCTATTGCTGCTGCTTGTCATATGGAACTTCATCAGTTGGACATTAATAATGCCTTCTTACATGGGTTTATTGACGAAGACTTGTATATGCATCCACCGTGGTTTATACCAAAGCTAAACCACATTAGGTTT


Protein sequences

Name Description Sequence
reverse transcriptase reverse transcriptase [Beta vulgaris].

MAIAAACHMELHQLDINNAFLHGFIDEDLYMHPPWFIPKLNHIRFQSKYNYSMFTLKYGDSYTVVVAYVDDLLLVGTHLSSIQHLKEQPHAAFTIKDLGPLKYFLGVEVTRDSTGILLNQRNQFLCAPRVPHFLAAQHVLDWGACIDSARSLTGYCVFLGISLISWKSKKQKVVSKSSTEAEYRSMSHTTIPVTALPS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11439
1-190 PTHR11439,GAG-POL-RELATED RETROTRANSPOSON

MAIAAACHMELHQLDINNAFLHGFIDEDLYMHPPWFIPKLNHIRFQSKYNYSMFTLKYGDSYTVVVAYVDDLLLVGTHLSSIQHLKEQPHAAFTIKDLGPLKYFLGVEVTRDSTGILLNQRNQFLCAPRVPHFLAAQHVLDWGACIDSARSLTGYCVFLGISLISWKSKKQKVVSKSSTEAEYRSMSHTT

HMMPfam: PF07727
IPR013103
1-34 RVT_2
Reverse transcriptase, RNA-dependent DNA polymeras

MAIAAACHMELHQLDINNAFLHGFIDEDLYMHPP

superfamily: SSF56672
8-196 SSF56672

HMELHQLDINNAFLHGFIDEDLYMHPPWFIPKLNHIRFQSKYNYSMFTLKYGDSYTVVVAYVDDLLLVGTHLSSIQHLKEQPHAAFTIKDLGPLKYFLGVEVTRDSTGILLNQRNQFLCAPRVPHFLAAQHVLDWGACIDSARSLTGYCVFLGISLISWKSKKQKVVSKSSTEAEYRSMSHTTIPVTAL

HMMPfam: PF07727
IPR013103
44-122 RVT_2
Reverse transcriptase, RNA-dependent DNA polymeras

RFQSKYNYSMFTLKYGDSYTVVVAYVDDLLLVGTHLSSIQHLKEQPHAAFTIKDLGPLKYFLGVEVTRDSTGILLNQRN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox