PRGDB00050102 (CK1)

From PRG Wiki
Jump to: navigation, search
CK1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121501692 (EF101866)
Gene Class Unknown
Domain Type
Gene Species Beta vulgaris

Comment?

Beta vulgaris RNA-directed DNA polymerase gene, partial cds; and heat stress transcription factor HSF, NPR1 (NPR1), hypothetical protein, integrase, hypothetical protein, retrotransposon proteins, hypothetical proteins, polynuclyotidyl transferase, transp

DNA Sequence

ATGGATATAGTTGTGGATGCTTTAGGGAATACTGAAGATCATGCTATGCTTGCCGGTTCAAACCCAGTTGAAGAAGAACCAAATGGTGAAGCAAAGAAGTTTTTCGACCTTCTCAAGGCGGCCGAGAATCCCTTGTATGAAGGGAGCAAGATGTCCGTGCTGGAGATGGTTTCTAGAATCATAAGTTTGAAGTGTGAGTATAACCTACCACACAGGTGTGTTGATGGGTTTCTTAGTTTACTGAATGAGGTGATACCCCAGAACAACAACATGGGAAAAACTTTCTATGAGACAAAGAAAGTTCTAAAGGGTTTGGAGCTTGCCCATGAGAGGATACATGCATGTCCTAAAGGTTGTATGTTGTATTGGAAGGGCGATGCTCACTTAGATAAATGTAGTGTATGCGGTAGTGATCGGTACAAGAAAACTTCTAAGGGCAAGCTTAATCCTGCAAAAGTGTTAATCTACTTTCCAATCACACCGAGGTTGCAGAGGTTGTTTGCAACTAAGAACATCTCTCAGGAAATGACATGGCATGCCGACAATCCTCGAATGCAAGGTACCTTAGCACATCCAAGTGACAGTGAAGCATGGAAACACTTTGATAGAACCTTTCCCGATTTCGCTGCTGAGGCTCGAAATGTTAGACTCGGGCTGTGCACCGACGGATTTTCTCCATATGGTAAGTTCGAAGGGGAATATTCATGCTGGCCAGTTATCCTCACACCATACAATTTGCCTCCATCCATGTGCATGAAGAAACCATTCATGTTTCTTTCTTTGCTCGTTCCGGGGCCTAAAAATCCCAAAGCAAACTTGGATGTGTTTATGCAACCTCTAGTTGAAGAATTGAAGCAGTTGTGGCATATTGGGGCTATGACCTATGATGTTTCAAGGAAGCAAAATTTCAACCTTCGAGCAGCGCTGCTTTGGACAATTAGTGACTTTCCTGCGTATGGTATGTTGTCCGGATGGTCTACTGCTGGAAAGAAGGCATGCCCTTATTGCATGGATAAAAGTAAGGCATTCTGGCTTGAACATGGGGGTAAAGTGACATGGTTCGATTGTCATCGACAATTTCTTCATTCTGACCACCCATTTCGAAAGAATAAGACTGCTTTTTGTAAGAATAGGGTTGAGAATGGCGTAGCTCCTCACATAATGTCTGGAGAGGAACTGTGGCAGTGCGTGAAAGACTTACCTAAAGCAACTGATGGTCCCGAGGCGCTGAACCGATTGAAGAAGGATAAAAAAGGTTGGTTGAAACAAAATATTCTGTGGGAGCTTCCATATTGGAAAGATTTAATTATCCGTCACAACTTAGATGTCATGCATGTTGAGAAGAATTTTTTCGACCAACTCATTAACACTGTGATGGATGTGAAGGGTCAAACTTCAGACACCCTTAGTGCAAGAAAGGACATGACACGTGTTTGCAAACGTCATGAATTGGAGCTTGTTGATGATGGTGTGGGAAATTTGACTAAGCCTAAAGCACCTTACACACTCGACAAAGCTCAGAAAAAGGTATTTTGTGAGTGGGTACGTGACTTGAAGTTTCCAGATGACTTTGCATCGAACTTGAGTAGATGCGTGGATCTTAGTTCTAGTAAATTGCAAGGATTGAAGAGTCATGACTGTCATGTATTCATGGAGAGGTTGTTGCCGGTTGGTCTAAAAGAATTGCTTCCTTTGCATGTTTGGAAGGCGATAACCGAAATAAGTCAATTCTTTCGAGACTTGTGTGCGTCCACAATAAAAGTCAGTGAGATGAAGCGCTTAGAGAACAACATCGCTGAGATCTTATGCAAGTTGGAAAAAATCTTTCCTTCATCATTTTTTAATTCAATGGAGCACTTGCCGGTTCACTTGCCTTATGAAGCAAAAGTTGGTGGCCCCGTCCAGTATAGGTGGATGTACCCTTTCGAAAGGTTGCTTAACCACTTAAAACGTAAAGTGGGAAACAAAGCACGTGTTGAAGGTTCAATATGCAATGCCTACCTAACTGAGGAGACAGCGAACTTCTGCTCCAACTACTTTCAACCCGGGGTTGACACAAAATCAAGGGACTTAGGAAGAAATGTCAATCCTGATGTTGCTAGCACACATGGTCTTGGTGTCCCCGAGTTGTTCAGGGAAGACTGCGGTCGACGGGGAACAGATGGACGTTTGCGATGGTTGCAAGACAAGGAGTACGATCGAGCACATCTTTACGTACTTGCAAACAGTGGCATCTTAAGTGATTATGAAAGGCAATTCGAGGATTATATTGTCAATTCAATACCGAACATTGCTAAGCATGATGTGTGGAGCAAATGCGAAGCCGAGTTCCCTAGTTGGTTCAAGACAAATGTCCTTGGTGCCATGATAAGTGACGATGTCACTCGAGCTCTTGCTATGGGTCCTTCCAGACAAGTGAGAATGTGGAATCAGTTTTTTGTGAATGGATATAACTTTCATACACAGGAATATGGCAAGAATAAGTCAACTATGAACTATGGTGTATGTGTACAAGCTGCTGATAGAGTTGATTACTTTGGCATTTTAGAGGAGGTTATTGAACTGGTGTACCATGGTAATTTGGGTGTTTATAAGACAATTTTGTTCAAGTGCAATTGGATGAACTCGGACAAAGGTATGAACATTCATGAACAGTACAAACTTGTGGAAGTCAATCACACCAAAAAATACCCAAAATATGATCCGTTTGTATTGTCGTACCAAGTTAGCCAAGTATACTACGCGTCGTATCCCAGTCTTAGGAGGGATAAAGTGCAATGGTGGGCTGTGTTTAAAACGAAGGCAAGGTCCGAAGTTGATGCCCCGGTTGATTTGGATGTTCTCCAGGAGGAAAGAGTTGATACCGCTGCAGTTCTTTGTGCTCCGGATGAGATACCAGATTATGATGCTGGTGACGACAACAATAATGATGAGATCGTGGAATTTGAGGCGCCGAATGAACAAGGAGAACCAAGTGAATATGAAAGCAGCGACGAGACTGGTGATTTGACTGACGATGATGATGATGACGAGGATGATTTGTTTGATGACCTTTTGCAGATGTCATCAGGTACCGGATCCGGAGGTGGTCCTCGTGATGGGGGTAGTGAGCCTCAACCTGAGCGTGATGGCGAGTTGGAGAGGGACGAGGATAATCATGAGGCTGGGGAAGGTGACAAGAAAAAGGAGTTGGATCCCAATGGACTTTGGTTTGAAGACAATGGAGTCATTCGCAACATGACTAAATGCTTCAAGCAACATTTCCATCATCCATGGAGGAACTATTCGCAGGTTGATGACGATACAAAAAACCTTTGGTTCTCTATTTTCAAGGGCTCATATAAATGGAGGGGGGAGCTTCAATCCCAAGTGAGGTCTACATACGACAGGAAAATGGCCAAAAGATTGAAAGATAATCACCACTCGATAGTAAAGAAGAAGGGTGGTGTTTGTCCGACATGGTTGTCTCTGAGCATTCATGAGCAGATGATGAAGAATGCTGAAGACAAGGAGTTCAAAGCACGATCTCAGAAGGCTAGCAAGAACCGGCGAGGAGGTGACTTGACCAGCAGCGTACCTCCTTCTCATGTCCAGGGCTCTATTTCCTCAGCAGAGCGCGCCAAGAGATTGGCCGCACAGCGTGGAGGGATGCTGCCTTCCGCTGTGGACTTGTTCATGGACACACACATGAGGGATGAGTCTGGAAAGAAGGTGCCGATCAACGACAAAGTCCAAAAAATCAAGGAAAGTTATGACAAAACTCTTGCTCAATGTGAAGAAAGAGGTGAAACCAAGGCCCCGAACCAGATTTTCTTTGAGACTGTTGGTGGCAGAAAGAAAGGGTGGGTTCCTGGTTTGGGGACGAGTGCAGACCTCTATTTTGAGAGGTCTTCGAGGGGAGGAGGTAGTTCGTCCTCCAGTTGCAGTCCTTCCATGTTTTCTCAGATGTCTGCGAAGTTCGAGGAAGAGAGAGCCGAGATGCAAAGAGAACGTGAGCGGATGCAGAAGGTGATAGAAGAGGAACGCATCGCCAGGAAAAAGGAGAGAGAGGAGGATCGCAGGGTGTATGATGAGTACCTGGCGCAGATGAGGGCGACTATGGAGACATACAGCCAGATGATGAGCCAGTGTGGTGGTTCATTCCCCTCTCCCGGGCCTCGAGACCCCCCCACCGGCGGTGGTGATGCGTGTGCGACTTAG


Protein sequences

Name Description Sequence
transposon-like protein transposon-like protein [Beta vulgaris].

MDIVVDALGNTEDHAMLAGSNPVEEEPNGEAKKFFDLLKAAENPLYEGSKMSVLEMVSRIISLKCEYNLPHRCVDGFLSLLNEVIPQNNNMGKTFYETKKVLKGLELAHERIHACPKGCMLYWKGDAHLDKCSVCGSDRYKKTSKGKLNPAKVLIYFPITPRLQRLFATKNISQEMTWHADNPRMQGTLAHPSDSEAWKHFDRTFPDFAAEARNVRLGLCTDGFSPYGKFEGEYSCWPVILTPYNLPPSMCMKKPFMFLSLLVPGPKNPKANLDVFMQPLVEELKQLWHIGAMTYDVSRKQNFNLRAALLWTISDFPAYGMLSGWSTAGKKACPYCMDKSKAFWLEHGGKVTWFDCHRQFLHSDHPFRKNKTAFCKNRVENGVAPHIMSGEELWQCVKDLPKATDGPEALNRLKKDKKGWLKQNILWELPYWKDLIIRHNLDVMHVEKNFFDQLINTVMDVKGQTSDTLSARKDMTRVCKRHELELVDDGVGNLTKPKAPYTLDKAQKKVFCEWVRDLKFPDDFASNLSRCVDLSSSKLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCASTIKVSEMKRLENNIAEILCKLEKIFPSSFFNSMEHLPVHLPYEAKVGGPVQYRWMYPFERLLNHLKRKVGNKARVEGSICNAYLTEETANFCSNYFQPGVDTKSRDLGRNVNPDVASTHGLGVPELFREDCGRRGTDGRLRWLQDKEYDRAHLYVLANSGILSDYERQFEDYIVNSIPNIAKHDVWSKCEAEFPSWFKTNVLGAMISDDVTRALAMGPSRQVRMWNQFFVNGYNFHTQEYGKNKSTMNYGVCVQAADRVDYFGILEEVIELVYHGNLGVYKTILFKCNWMNSDKGMNIHEQYKLVEVNHTKKYPKYDPFVLSYQVSQVYYASYPSLRRDKVQWWAVFKTKARSEVDAPVDLDVLQEERVDTAAVLCAPDEIPDYDAGDDNNNDEIVEFEAPNEQGEPSEYESSDETGDLTDDDDDDEDDLFDDLLQMSSGTGSGGGPRDGGSEPQPERDGELERDEDNHEAGEGDKKKELDPNGLWFEDNGVIRNMTKCFKQHFHHPWRNYSQVDDDTKNLWFSIFKGSYKWRGELQSQVRSTYDRKMAKRLKDNHHSIVKKKGGVCPTWLSLSIHEQMMKNAEDKEFKARSQKASKNRRGGDLTSSVPPSHVQGSISSAERAKRLAAQRGGMLPSAVDLFMDTHMRDESGKKVPINDKVQKIKESYDKTLAQCEERGETKAPNQIFFETVGGRKKGWVPGLGTSADLYFERSSRGGGSSSSSCSPSMFSQMSAKFEEERAEMQRERERMQKVIEEERIARKKEREEDRRVYDEYLAQMRATMETYSQMMSQCGGSFPSPGPRDPPTGGGDACAT

transposon-like protein transposon-like protein [Beta vulgaris].

MDIVVDALGNTEDHAMLAGSNPVEEEPNGEAKKFFDLLKAAENPLYEGSKMSVLEMVSRIISLKCEYNLPHRCVDGFLSLLNEVIPQNNNMGKTFYETKKVLKGLELAHERIHACPKGCMLYWKGDAHLDKCSVCGSDRYKKTSKGKLNPAKVLIYFPITPRLQRLFATKNISQEMTWHADNPRMQGTLAHPSDSEAWKHFDRTFPDFAAEARNVRLGLCTDGFSPYGKFEGEYSCWPVILTPYNLPPSMCMKKPFMFLSLLVPGPKNPKANLDVFMQPLVEELKQLWHIGAMTYDVSRKQNFNLRAALLWTISDFPAYGMLSGWSTAGKKACPYCMDKSKAFWLEHGGKVTWFDCHRQFLHSDHPFRKNKTAFCKNRVENGVAPHIMSGEELWQCVKDLPKATDGPEALNRLKKDKKGWLKQNILWELPYWKDLIIRHNLDVMHVEKNFFDQLINTVMDVKGQTSDTLSARKDMTRVCKRHELELVDDGVGNLTKPKAPYTLDKAQKKVFCEWVRDLKFPDDFASNLSRCVDLSSSKLQGLKSHDCHVFMERLLPVGLKELLPLHVWKAITEISQFFRDLCASTIKVSEMKRLENNIAEILCKLEKIFPSSFFNSMEHLPVHLPYEAKVGGPVQYRWMYPFERLLNHLKRKVGNKARVEGSICNAYLTEETANFCSNYFQPGVDTKSRDLGRNVNPDVASTHGLGVPELFREDCGRRGTDGRLRWLQDKEYDRAHLYVLANSGILSDYERQFEDYIVNSIPNIAKHDVWSKCEAEFPSWFKTNVLGAMISDDVTRALAMGPSRQVRMWNQFFVNGYNFHTQEYGKNKSTMNYGVCVQAADRVDYFGILEEVIELVYHGNLGVYKTILFKCNWMNSDKGMNIHEQYKLVEVNHTKKYPKYDPFVLSYQVSQVYYASYPSLRRDKVQWWAVFKTKARSEVDAPVDLDVLQEERVDTAAVLCAPDEIPDYDAGDDNNNDEIVEFEAPNEQGEPSEYESSDETGDLTDDDDDDEDDLFDDLLQMSSGTGSGGGPRDGGSEPQPERDGELERDEDNHEAGEGDKKKELDPNGLWFEDNGVIRNMTKCFKQHFHHPWRNYSQVDDDTKNLWFSIFKGSYKWRGELQSQVRSTYDRKMAKRLKDNHHSIVKKKGGVCPTWLSLSIHEQMMKNAEDKEFKARSQKASKNRRGGDLTSSVPPSHVQGSISSAERAKRLAAQRGGMLPSAVDLFMDTHMRDESGKKVPINDKVQKIKESYDKTLAQCEERGETKAPNQIFFETVGGRKKGWVPGLGTSADLYFERSSRGGGSSSSSCSPSMFSQMSAKFEEERAEMQRERERMQKVIEEERIARKKEREEDRRVYDEYLAQMRATMETYSQMMSQCGGSFPSPGPRDPPTGGGDACAT

Domains

Domain Start-End Description Sequence

HMMPfam: PF02992
IPR004242
175-400 Transposase_21
Transposon, En/Spm-like

EMTWHADNPRMQGTLAHPSDSEAWKHFDRTFPDFAAEARNVRLGLCTDGFSPYGKFEGEYSCWPVILTPYNLPPSMCMKKPFMFLSLLVPGPKNPKANLDVFMQPLVEELKQLWHIGAMTYDVSRKQNFNLRAALLWTISDFPAYGMLSGWSTAGKKACPYCMDKSKAFWLEHGGKVTWFDCHRQFLHSDHPFRKNKTAFCKNRVENGVAPHIMSGEELWQCVKDL

HMMPfam: PF02992
IPR004242
175-400 Transposase_21
Transposon, En/Spm-like

EMTWHADNPRMQGTLAHPSDSEAWKHFDRTFPDFAAEARNVRLGLCTDGFSPYGKFEGEYSCWPVILTPYNLPPSMCMKKPFMFLSLLVPGPKNPKANLDVFMQPLVEELKQLWHIGAMTYDVSRKQNFNLRAALLWTISDFPAYGMLSGWSTAGKKACPYCMDKSKAFWLEHGGKVTWFDCHRQFLHSDHPFRKNKTAFCKNRVENGVAPHIMSGEELWQCVKDL

HMMPfam: PF13960
IPR025452
570-687 DUF4218
Domain of unknown function DUF4218

AITEISQFFRDLCASTIKVSEMKRLENNIAEILCKLEKIFPSSFFNSMEHLPVHLPYEAKVGGPVQYRWMYPFERLLNHLKRKVGNKARVEGSICNAYLTEETANFCSNYFQPGVDTK

HMMPfam: PF13960
IPR025452
570-687 DUF4218
Domain of unknown function DUF4218

AITEISQFFRDLCASTIKVSEMKRLENNIAEILCKLEKIFPSSFFNSMEHLPVHLPYEAKVGGPVQYRWMYPFERLLNHLKRKVGNKARVEGSICNAYLTEETANFCSNYFQPGVDTK

HMMPfam: PF13952
IPR025312
853-931 DUF4216
Domain of unknown function DUF4216

IELVYHGNLGVYKTILFKCNWMNSDKGMNIHEQYKLVEVNHTKKYPKYDPFVLSYQVSQVYYASYPSLRRDKVQWWAVF

HMMPfam: PF13952
IPR025312
853-931 DUF4216
Domain of unknown function DUF4216

IELVYHGNLGVYKTILFKCNWMNSDKGMNIHEQYKLVEVNHTKKYPKYDPFVLSYQVSQVYYASYPSLRRDKVQWWAVF

HMMPfam: PF03004
IPR004252
1161-1288 Transposase_24
Transposase, Ptta/En/Spm, plant

EQMMKNAEDKEFKARSQKASKNRRGGDLTSSVPPSHVQGSISSAERAKRLAAQRGGMLPSAVDLFMDTHMRDESGKKVPINDKVQKIKESYDKTLAQCEERGETKAPNQIFFETVGGRKKGWVPGLGT

HMMPfam: PF03004
IPR004252
1161-1288 Transposase_24
Transposase, Ptta/En/Spm, plant

EQMMKNAEDKEFKARSQKASKNRRGGDLTSSVPPSHVQGSISSAERAKRLAAQRGGMLPSAVDLFMDTHMRDESGKKVPINDKVQKIKESYDKTLAQCEERGETKAPNQIFFETVGGRKKGWVPGLGT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox