PRGDB00050107 (CK1)

From PRG Wiki
Jump to: navigation, search
CK1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121501692 (EF101866)
Gene Class Unknown
Domain Type LRR
Gene Species Beta vulgaris

Comment?

Beta vulgaris RNA-directed DNA polymerase gene, partial cds; and heat stress transcription factor HSF, NPR1 (NPR1), hypothetical protein, integrase, hypothetical protein, retrotransposon proteins, hypothetical proteins, polynuclyotidyl transferase, transp

DNA Sequence

ATGGCTAACAACACTGAACTAGCTGACGCTATTCGCCTCTTGGCGGAGAAACTGAACCAGGACAGGGTTGAACGTCCAGAGACTGCTGGAGAAATGTTTGAAAGACTGTCCAAAGTGAAACCACCATACTTTAAGGGACAAGCTGACCCTACTTTCTTAGAAAACTGGATTAGGGAATTTGAAAAGTTGTTTGAGGTAGTGAATTGCCCTGCTGACATGAGAGTAGGACAAGCTGTTTTATACCTAAAAGATGAGGCTGACTTGTGGTGGAGAGAAAATGGGGCTAGATTGAGTGCTGCTGAGGGATTCAATTGGGAAGCCTTTGTGATTGTGCTGAGAGGAAAGTTTTACCCTGCCTTCATGAGGAAGCAGAAAGCCCAAGAGTTCATCAACCTTAGAATGGGTAGTATGACCATTTCTGAATACTATAGTAAGTTCATAGCCTTGTCTAGGTTTGCACCTGAGGTTGTAGCTACTGAAGAGCTTAAGGCTCAGAGGTTCGAACAGGGATTGACTGATGAGATCCAGCTGGGATTAGGGGGTGAGACCTTTACATCCTTAGATGTTGTGTATGGGAGAGCTTCTCATATTTATGGGTTGCAATCGAGAAGAGATAAGAAGGCTGGAATAGTTGGTGAGAAGAGAAAGGAGGTTAGTACTGGAGGAAACCAAAATAACTTTAAGAAAAACCGGAATGGGAATGGAAACTTTCAAGGAAGGAACAACCAGGATAATCGTAGTCAGGGTAGACCTGAGAGGGTTCATATTTGTAAGTTCTGTGACAAAAACCATCCTGGGAAAGACTGTAAAGGAGAGCTAGTGACCTGTCATTACTGCCAGAAGAAGGGTCACAGAGAGTATGAGTGCTACACTAAGCACGGAAAAGGTTTGAAAATTCAGGGAAACGGTAATCAGGCTAGACCAGGGTCTAATCAGATAGGGAACCAGGGTCCTAAACCTGGAGGTCAAAATAACCAAGGGAACCATAGTAGGCCTGCTGCTAATGATAATTCTGCCCAGAACAAACCTGCAGGAAAAGTGTTCGTGATGAGTCATAACGAGGCAGAGAGATCTGCGGATGTGGTAACTGGTAATTTCTCTATCAACTCAGTTTTCGTTAAAACGTTATTCGATTCGGGGGCTACTTATTCTTTTATTTCGCCTTCTGTTTTAAAGAGTCTGGGATTGGTGGAGCATGAGTCAATTGACTTGTCTGTTAGTATTCCTACTGGGGAAGTCGTTAAGTGTACTAAGTTATTTAAGAACTTACCTTTGAAGATAGGAGGGAGTGTTTTTCCATCCGAATTGATCGAGTTTAACTTAGGAGATTTAGATGTGATTCTTGGGATGAACTGGTTGAGTCTTTACAAGGCCAGGATCGATTGTGAAGTCCAGAAAGTAGTGTTGAGAAACCCTTCGGGAAAATTTACCTCATATAGACGATTTGGGAAACCTAAAAACTTTGGAGTGATCTCTGCTCTACAAGTGCAGAAGTTGATGAGAAAGGGGTGTGAACTGTTTTTCTGTAGTGTGCAAGATGTGAGTAAAGAAGCTGAGTTAAAACTTGAGGATGTTTCAATAGTGAATGAGTTTATGGACGTATTTCCGAGTGAAATTTCAGGTATGCCGCCTGCAAGAGCCGTTGAGTTTACCATAGACTTAGTTCCTGGAACTGCACCTATATCTAAGGCACCTTATAGAATGGCACCTCCTGAGATGAGTGAATTAAAGACGCAATTGCAAGAACTTTTGGATAAGGGTTATATCAGACCTAGTGCATCGCCTTGGGGAGCTCCTGTTTTGTTCGTGAAGAAAAAGGATGGGAGTATGAGGTTATGTATCGACTATAGGGAGTTGAATAATGTTACCATCAAGAACAAGTACCCTTTGCCTAGAATAGATGACCTATTCGATCAATTGAACGGAGCTAGTGTGTTCTCGAAGATTGACTTACGTTCAGGATATCACCAGTTGAGGGTAGCTGATAAGGATGTACCTAAGACTGCTTTTAGAACGCGTTATGGTCACTACGAGTTCACTGTAATGCCATTTGGGTTAACCAATGCTCCTGCTATATTTATGGACCTGATGAACAGAATCTTTCATGAGTTTTTAGACAAGTTCGTAGTGGTTTTCATCGATGACATTTTGATTTATTCGAGGAATGAAACCGAACACGATGAACATTTGAGGATTATCTTAGAAACCTTGAGGAAGAACCAATTATATGCCAAGTTCTCTAAGTGTGAGTTTCGTTTGGAGAAAGTAGCATTCTTGGGTCATTTTGTGTCTAAGGAAGGAGTATCTGTAGATCCTGCTAAGATTCAAGCTGTGAGTGAGTGGCCAACTCCAAAGAGTGTGACCGACATTAGAAGTTTCTTGGGTTTAGCTGGCTATTATAGGAGATTTGTGAGGGATTTCTCGAAGATAGCGAGACCTATGACGAATTTAATGAAAAAGGAGACCAAGTTTGAGTGGAATGAGAAGTGTGAGGAAGCCTTCCAGATCTTGAAAGATCGTTTAACCACTGCACCTGTCTTAACCCTACCTGACGGGAATGAGGGATTTGAGGTCTATAGTGATGCTTCGAAGAATGGTTTGGGTTGTGTATTGCAACAGAATGGGAAGGTAATAGCTTATGCATCGTGTCAACTGAAACCTTATGAGGCAAATTACCCTACCCATGATCTAGAGTTAGCTGCCATAGTATTTGCATTGAAGATTTGGAGACATTATCTTTATGGGGCGACCTGCAAGATATTCACAGACCATAAGAGCTTGAAATACATATTTACCCAAAAAGACTTGAACATGAGACAAAGGAGATGGCTAGAGTTGATTAAAGATTACGATCTAGACATCCAGTATCATGAAGGGAAAGCCAATGTGGTGGCTGACGCCTTGAGTAGGAAATCGAGTCATAGCCTGAGTACTTTGATAGTTCCTGAGGAGTTGTGCAGAGATATGAAAAGGTTGAACCTAGAAATTTTAAATCCTGGGGAAAGTGAGGCGAGACTCAGCAATCTCTCTTTGGGAGTGTCAATTTTCGATGAGATCATTGAGGGGCAAGTTGGGGATGAGCATCTAGATAAGATAAAAGAGAAAATGAAGCAAGGTAAAGAAATAGACTTCAAGATTCATGAAGATGGGAGTCTAAGGTTTAAGGGACGGTGGTGTGTACCACAGAAGTGTAACGATCTAAAGAGACGTCTTATGGATGAGGGACATAATACTCCGTATTCTGTGCACCCTGGGGGTGACAAGCTGTATAAGGATCTTAAGGTGATATACTGGTGGCCGAACATGAAACGAGAGGTAGCCGAGTATGTGTCTAAGTGTCTAACCTGCCAGAAAGTGAAGATAGACCATAAGAGGCCCATGGGGACAGTCCAACCACTAGAGGTTCCTGGATGGAAGTGGGATTCGATTTCTATGGACTTTGTGACTGCCTTACCCAAGTCGAGGAGTGGAAATGATACCATTTGGGTTATAGTGGATAGACTGACCAAGTCCGCCGTTTTCATACCCATTAAGGAGACATGGAAGAAGAAGCAACTCGCTACAACCTATATCAAGCATGTAGTGAGATTGCACGGAGTCCCAAAGGACATTATTTCAGACCGTGACTCTAGATTTCTATCTAAGTTTTGGAAGAAGGTACAAGCAAACCTTGGGACAACATTAAAGATGAGTACCGCCTTTCACCCTGCGACCGATGGTCAGACTGAGAGGACTAACCAAACTATGGAAGACATGCTGCGAGCTTGTGCTATAGATTTTCAAGGAAGTTGGGAGGACCAATTAGATTTGATTGAGTTCTCTTACAATAATAGTTACCATGCGAGTATCAAGATGGCACCTTTTGAGGCGTTATATGGTCGGAAGTGTAGAAGTCCCATTTGCTGGAACGACTATAGTGAGAATGTAGTTTTGGGGACAGAATTCATTGAGGAGACCGTCAAGAACGTTAGATTGATTCAGGCTAGAATTCAAGCTGCGCAAGATAGGCAGAAGAGTTACGCAGACTTAAAGCGGCGCGAAGATGAGTTCGCTGTAGGTGATAAAGTATTCCTGAAAGTATCACCCACCAAAGGCGTTATGCGATTTGGGAAAAAGGGCAAGCTGAGTGCTAAATATGTCGGCCCATATGAAATTTTGGAGCGCATTGGGAAAGTAGCTTATAGATTGGCATTGCCAATGGAGTTTGAAAAGATGCACGATGTGTTTCACATATCCCAATTGAAGCGCTATATCCCTGATGAGCGCCATGTGTTAGAGCCTGAACGAGTGCAGATAGATAGTAGCCTCACTTATGAGGAAAGACCTGTCAAGATTCTCGACAGGAAAGTGCGTAGTACGCGTAACAAGGATGTGCATATTGTCAAAGTTCTTTGGTCTAACCACGAGTCAGAAGAGGCAACGTGGGAAGCCGAAGAGGATATGAAGAAAAAGTATCCAGACCTATTCCTTGAGGTGAGTTACGAGGGCGTAACTCGTTTTCTTTAA


Protein sequences

Name Description Sequence
retrotransposon protein retrotransposon protein [Beta vulgaris].

MANNTELADAIRLLAEKLNQDRVERPETAGEMFERLSKVKPPYFKGQADPTFLENWIREFEKLFEVVNCPADMRVGQAVLYLKDEADLWWRENGARLSAAEGFNWEAFVIVLRGKFYPAFMRKQKAQEFINLRMGSMTISEYYSKFIALSRFAPEVVATEELKAQRFEQGLTDEIQLGLGGETFTSLDVVYGRASHIYGLQSRRDKKAGIVGEKRKEVSTGGNQNNFKKNRNGNGNFQGRNNQDNRSQGRPERVHICKFCDKNHPGKDCKGELVTCHYCQKKGHREYECYTKHGKGLKIQGNGNQARPGSNQIGNQGPKPGGQNNQGNHSRPAANDNSAQNKPAGKVFVMSHNEAERSADVVTGNFSINSVFVKTLFDSGATYSFISPSVLKSLGLVEHESIDLSVSIPTGEVVKCTKLFKNLPLKIGGSVFPSELIEFNLGDLDVILGMNWLSLYKARIDCEVQKVVLRNPSGKFTSYRRFGKPKNFGVISALQVQKLMRKGCELFFCSVQDVSKEAELKLEDVSIVNEFMDVFPSEISGMPPARAVEFTIDLVPGTAPISKAPYRMAPPEMSELKTQLQELLDKGYIRPSASPWGAPVLFVKKKDGSMRLCIDYRELNNVTIKNKYPLPRIDDLFDQLNGASVFSKIDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAPAIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCEFRLEKVAFLGHFVSKEGVSVDPAKIQAVSEWPTPKSVTDIRSFLGLAGYYRRFVRDFSKIARPMTNLMKKETKFEWNEKCEEAFQILKDRLTTAPVLTLPDGNEGFEVYSDASKNGLGCVLQQNGKVIAYASCQLKPYEANYPTHDLELAAIVFALKIWRHYLYGATCKIFTDHKSLKYIFTQKDLNMRQRRWLELIKDYDLDIQYHEGKANVVADALSRKSSHSLSTLIVPEELCRDMKRLNLEILNPGESEARLSNLSLGVSIFDEIIEGQVGDEHLDKIKEKMKQGKEIDFKIHEDGSLRFKGRWCVPQKCNDLKRRLMDEGHNTPYSVHPGGDKLYKDLKVIYWWPNMKREVAEYVSKCLTCQKVKIDHKRPMGTVQPLEVPGWKWDSISMDFVTALPKSRSGNDTIWVIVDRLTKSAVFIPIKETWKKKQLATTYIKHVVRLHGVPKDIISDRDSRFLSKFWKKVQANLGTTLKMSTAFHPATDGQTERTNQTMEDMLRACAIDFQGSWEDQLDLIEFSYNNSYHASIKMAPFEALYGRKCRSPICWNDYSENVVLGTEFIEETVKNVRLIQARIQAAQDRQKSYADLKRREDEFAVGDKVFLKVSPTKGVMRFGKKGKLSAKYVGPYEILERIGKVAYRLALPMEFEKMHDVFHISQLKRYIPDERHVLEPERVQIDSSLTYEERPVKILDRKVRSTRNKDVHIVKVLWSNHESEEATWEAEEDMKKKYPDLFLEVSYEGVTRFL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10178:SF14
19-1450 PTHR10178:SF14,RETROVIRUS POLYPROTEIN

NQDRVERPETAGEMFERLSKVKPPYFKGQADPTFLENWIREFEKLFEVVNCPADMRVGQAVLYLKDEADLWWRENGARLSAAEGFNWEAFVIVLRGKFYPAFMRKQKAQEFINLRMGSMTISEYYSKFIALSRFAPEVVATEELKAQRFEQGLTDEIQLGLGGETFTSLDVVYGRASHIYGLQSRRDKKAGIVGEKRKEVSTGGNQNNFKKNRNGNGNFQGRNNQDNRSQGRPERVHICKFCDKNHPGKDCKGELVTCHYCQKKGHREYECYTKHGKGLKIQGNGNQARPGSNQIGNQGPKPGGQNNQGNHSRPAANDNSAQNKPAGKVFVMSHNEAERSADVVTGNFSINSVFVKTLFDSGATYSFISPSVLKSLGLVEHESIDLSVSIPTGEVVKCTKLFKNLPLKIGGSVFPSELIEFNLGDLDVILGMNWLSLYKARIDCEVQKVVLRNPSGKFTSYRRFGKPKNFGVISALQVQKLMRKGCELFFCSVQDVSKEAELKLEDVSIVNEFMDVFPSEISGMPPARAVEFTIDLVPGTAPISKAPYRMAPPEMSELKTQLQELLDKGYIRPSASPWGAPVLFVKKKDGSMRLCIDYRELNNVTIKNKYPLPRIDDLFDQLNGASVFSKIDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAPAIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCEFRLEKVAFLGHFVSKEGVSVDPAKIQAVSEWPTPKSVTDIRSFLGLAGYYRRFVRDFSKIARPMTNLMKKETKFEWNEKCEEAFQILKDRLTTAPVLTLPDGNEGFEVYSDASKNGLGCVLQQNGKVIAYASCQLKPYEANYPTHDLELAAIVFALKIWRHYLYGATCKIFTDHKSLKYIFTQKDLNMRQRRWLELIKDYDLDIQYHEGKANVVADALSRKSSHSLSTLIVPEELCRDMKRLNLEILNPGESEARLSNLSLGVSIFDEIIEGQVGDEHLDKIKEKMKQGKEIDFKIHEDGSLRFKGRWCVPQKCNDLKRRLMDEGHNTPYSVHPGGDKLYKDLKVIYWWPNMKREVAEYVSKCLTCQKVKIDHKRPMGTVQPLEVPGWKWDSISMDFVTALPKSRSGNDTIWVIVDRLTKSAVFIPIKETWKKKQLATTYIKHVVRLHGVPKDIISDRDSRFLSKFWKKVQANLGTTLKMSTAFHPATDGQTERTNQTMEDMLRACAIDFQGSWEDQLDLIEFSYNNSYHASIKMAPFEALYGRKCRSPICWNDYSENVVLGTEFIEETVKNVRLIQARIQAAQDRQKSYADLKRREDEFAVGDKVFLKVSPTKGVMRFGKKGKLSAKYVGPYEILERIGKVAYRLALPMEFEKMHDVFHISQLKRYIPDERHVLEPERVQIDSSLTYEERPVKILDRKV

HMMPanther: PTHR10178
19-1450 PTHR10178,GAG/POL/ENV POLYPROTEIN

NQDRVERPETAGEMFERLSKVKPPYFKGQADPTFLENWIREFEKLFEVVNCPADMRVGQAVLYLKDEADLWWRENGARLSAAEGFNWEAFVIVLRGKFYPAFMRKQKAQEFINLRMGSMTISEYYSKFIALSRFAPEVVATEELKAQRFEQGLTDEIQLGLGGETFTSLDVVYGRASHIYGLQSRRDKKAGIVGEKRKEVSTGGNQNNFKKNRNGNGNFQGRNNQDNRSQGRPERVHICKFCDKNHPGKDCKGELVTCHYCQKKGHREYECYTKHGKGLKIQGNGNQARPGSNQIGNQGPKPGGQNNQGNHSRPAANDNSAQNKPAGKVFVMSHNEAERSADVVTGNFSINSVFVKTLFDSGATYSFISPSVLKSLGLVEHESIDLSVSIPTGEVVKCTKLFKNLPLKIGGSVFPSELIEFNLGDLDVILGMNWLSLYKARIDCEVQKVVLRNPSGKFTSYRRFGKPKNFGVISALQVQKLMRKGCELFFCSVQDVSKEAELKLEDVSIVNEFMDVFPSEISGMPPARAVEFTIDLVPGTAPISKAPYRMAPPEMSELKTQLQELLDKGYIRPSASPWGAPVLFVKKKDGSMRLCIDYRELNNVTIKNKYPLPRIDDLFDQLNGASVFSKIDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAPAIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCEFRLEKVAFLGHFVSKEGVSVDPAKIQAVSEWPTPKSVTDIRSFLGLAGYYRRFVRDFSKIARPMTNLMKKETKFEWNEKCEEAFQILKDRLTTAPVLTLPDGNEGFEVYSDASKNGLGCVLQQNGKVIAYASCQLKPYEANYPTHDLELAAIVFALKIWRHYLYGATCKIFTDHKSLKYIFTQKDLNMRQRRWLELIKDYDLDIQYHEGKANVVADALSRKSSHSLSTLIVPEELCRDMKRLNLEILNPGESEARLSNLSLGVSIFDEIIEGQVGDEHLDKIKEKMKQGKEIDFKIHEDGSLRFKGRWCVPQKCNDLKRRLMDEGHNTPYSVHPGGDKLYKDLKVIYWWPNMKREVAEYVSKCLTCQKVKIDHKRPMGTVQPLEVPGWKWDSISMDFVTALPKSRSGNDTIWVIVDRLTKSAVFIPIKETWKKKQLATTYIKHVVRLHGVPKDIISDRDSRFLSKFWKKVQANLGTTLKMSTAFHPATDGQTERTNQTMEDMLRACAIDFQGSWEDQLDLIEFSYNNSYHASIKMAPFEALYGRKCRSPICWNDYSENVVLGTEFIEETVKNVRLIQARIQAAQDRQKSYADLKRREDEFAVGDKVFLKVSPTKGVMRFGKKGKLSAKYVGPYEILERIGKVAYRLALPMEFEKMHDVFHISQLKRYIPDERHVLEPERVQIDSSLTYEERPVKILDRKV

HMMPfam: PF03732
IPR005162
78-173 Retrotrans_gag
Retrotransposon gag protein

AVLYLKDEADLWWRENGARLSAAEGFNWEAFVIVLRGKFYPAFMRKQKAQEFINLRMGSMTISEYYSKFIALSRFAPEVVATEELKAQRFEQGLTD

HMMSmart: SM00343
IPR001878
275-291 ZnF_C2HC
Zinc finger, CCHC-type

TCHYCQKKGHREYECYT

HMMPfam: PF08284
IPR013242
345-475 RVP_2
Retroviral aspartyl protease

GKVFVMSHNEAERSADVVTGNFSINSVFVKTLFDSGATYSFISPSVLKSLGLVEHESIDLSVSIPTGEVVKCTKLFKNLPLKIGGSVFPSELIEFNLGDLDVILGMNWLSLYKARIDCEVQKVVLRNPSGK

superfamily: SSF50630
IPR021109
354-462 Pept_Aspartic
Peptidase aspartic

EAERSADVVTGNFSINSVFVKTLFDSGATYSFISPSVLKSLGLVEHESIDLSVSIPTGEVVKCTKLFKNLPLKIGGSVFPSELIEFNLGDLDVILGMNWLSLYKARIDC

superfamily: SSF56672
526-957 SSF56672

SIVNEFMDVFPSEISGMPPARAVEFTIDLVPGTAPISKAPYRMAPPEMSELKTQLQELLDKGYIRPSASPWGAPVLFVKKKDGSMRLCIDYRELNNVTIKNKYPLPRIDDLFDQLNGASVFSKIDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAPAIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCEFRLEKVAFLGHFVSKEGVSVDPAKIQAVSEWPTPKSVTDIRSFLGLAGYYRRFVRDFSKIARPMTNLMKKETKFEWNEKCEEAFQILKDRLTTAPVLTLPDGNEGFEVYSDASKNGLGCVLQQNGKVIAYASCQLKPYEANYPTHDLELAAIVFALKIWRHYLYGATCKIFTDHKSLKYIFTQKDLNMRQRRWLELIKDYDLDIQYH

Gene3D: G3DSA:3.10.10.10
555-643 G3DSA:3.10.10.10

VPGTAPISKAPYRMAPPEMSELKTQLQELLDKGYIRPSASPWGAPVLFVKKKDGSMRLCIDYRELNNVTIKNKYPLPRIDDLFDQLNGA

ProfileScan: PS50878
IPR000477
584-763 RT_POL
Reverse transcriptase

LDKGYIRPSASPWGAPVLFVKKKDGSMRLCIDYRELNNVTIKNKYPLPRIDDLFDQLNGASVFSKIDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAPAIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCEFRLEKVAFLGHFV

HMMPfam: PF00078
IPR000477
603-761 RVT_1
Reverse transcriptase

VKKKDGSMRLCIDYRELNNVTIKNKYPLPRIDDLFDQLNGASVFSKIDLRSGYHQLRVADKDVPKTAFRTRYGHYEFTVMPFGLTNAPAIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCEFRLEKVAFLGH

Gene3D: G3DSA:3.30.70.270
644-655 G3DSA:3.30.70.270

SVFSKIDLRSGY

Gene3D: G3DSA:3.30.70.270
690-771 G3DSA:3.30.70.270

PAIFMDLMNRIFHEFLDKFVVVFIDDILIYSRNETEHDEHLRIILETLRKNQLYAKFSKCEFRLEKVAFLGHFVSKEGVSVD

ProfileScan: PS50994
IPR001584
1132-1295 INTEGRASE
Integrase, catalytic core

PLEVPGWKWDSISMDFVTALPKSRSGNDTIWVIVDRLTKSAVFIPIKETWKKKQLATTYIKHVVRLHGVPKDIISDRDSRFLSKFWKKVQANLGTTLKMSTAFHPATDGQTERTNQTMEDMLRACAIDFQGSWEDQLDLIEFSYNNSYHASIKMAPFEALYGRK

superfamily: SSF53098
IPR012337
1132-1301 RNaseH_fold
Ribonuclease H-like domain

PLEVPGWKWDSISMDFVTALPKSRSGNDTIWVIVDRLTKSAVFIPIKETWKKKQLATTYIKHVVRLHGVPKDIISDRDSRFLSKFWKKVQANLGTTLKMSTAFHPATDGQTERTNQTMEDMLRACAIDFQGSWEDQLDLIEFSYNNSYHASIKMAPFEALYGRKCRSPIC

Gene3D: G3DSA:3.30.420.10
1135-1288 G3DSA:3.30.420.10

VPGWKWDSISMDFVTALPKSRSGNDTIWVIVDRLTKSAVFIPIKETWKKKQLATTYIKHVVRLHGVPKDIISDRDSRFLSKFWKKVQANLGTTLKMSTAFHPATDGQTERTNQTMEDMLRACAIDFQGSWEDQLDLIEFSYNNSYHASIKMAPF

HMMPfam: PF00665
IPR001584
1139-1252 rve
Integrase, catalytic core

KWDSISMDFVTALPKSRSGNDTIWVIVDRLTKSAVFIPIKETWKKKQLATTYIKHVVRLHGVPKDIISDRDSRFLSKFWKKVQANLGTTLKMSTAFHPATDGQTERTNQTMEDM

superfamily: SSF54160
IPR016197
1417-1488 Chromodomain-like
Chromo domain-like

YIPDERHVLEPERVQIDSSLTYEERPVKILDRKVRSTRNKDVHIVKVLWSNHESEEATWEAEEDMKKKYPDL

HMMPfam: PF00385
IPR023780
1442-1489 Chromo
Chromo domain

PVKILDRKVRSTRNKDVHIVKVLWSNHESEEATWEAEEDMKKKYPDLF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox