PRGDB00050109 (CK1)

From PRG Wiki
Jump to: navigation, search
CK1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121501692 (EF101866)
Gene Class Unknown
Domain Type
Gene Species Beta vulgaris

Comment?

Beta vulgaris RNA-directed DNA polymerase gene, partial cds; and heat stress transcription factor HSF, NPR1 (NPR1), hypothetical protein, integrase, hypothetical protein, retrotransposon proteins, hypothetical proteins, polynuclyotidyl transferase, transp

DNA Sequence

ATGAATACCACCGAGAAACTTGAAGAAGGTTATTCCACTCAAAGGCCTCCTATGTTCAATGGGAAGTACTACAACTATTGGAAGAACCGCATGGAGATATTCATCAAGGCTGAAAACTATCAGGTATGGAGAGTCATTGAAGTTGGCGATTTCGAAGTCACAACTACAAATGACAAAAATGAGGTAACTCTTAAACCCCTCTCTGATTATGACAAATCTGATTTTGAAAAAATGGAAGTAAATGCCATGGCTATTAAATTATTGCATTGTGGACTTGGACCCCATGAACATAATAGGATCATGGGATGCAAATCCGCAAAGCAAATATGGGATTTACTAGAAGTAACCCACGAAGGAACTAATGAAGTTAAAAGATCGAAAATTGATTTACTTATGAATCAATATGAACTGTTCTGCATGAAATCCAAAGAAAGCATCCGAGACATGTTTACTCGTTTTACTAACATTATAAATGAGTTGGCTTCTCTTGGAAAGTTTATTTCATCTGAGGAACAGGTTCGAAAGGTTCTTAGGAGTCTTCCTAAGGACAGATGGATGACTAAAGTCACGGCTCTTCAAGAAACAAAAGACTTCACTAAGTTCAACTTAGAACAGCTGGCAGGGTCACTTATGACTCATGAGCTTCACCTTGATACTGAATATGGTGAAAGCTCCAAATCAAAATCAATTGCTCTCAAAGCAGATGATGAAGATGATTCGGACTCTGAAGAAGAAGAAGCAGCCCTCATGGTTCGAAAATTTCGAAAGATGTACAGGAACATGAAGAATGGAAACTTCAAAGGTAAAACTAAGAAATTTTCTAACAAAGCTGCTTGTCATAAATGTGGAAGTACAGATCACTTCATTAAAGAATGTCCTCTTTGGGAAAACGACAAAACCAAAGAAAGGAACAAGGAACGCTTTGCTGAAAGGAACAAAGAATCAAAAGCACCTTTCTCTAAGGCAAATGTGCGCAAAGCTATGATAGCTGCTTGGGGAGATTCAGAGATGGAAGAAGAAGAGGAACAACCAACTGAAGAAACAGCAAACCTTTGCCTCATGGCAAACACTGACGAAAAAGAAGATGAAGAAATAATTGAGGTAAGTCAACATGGACTTGAGTCAGAACTAGATGGTAAAACTAGGACTGAAATATATGATCTTCTTTATGATGCAATTCTTGAATGTAGAGATGAACGTGAAAAACGTGAACAAACGGAACAAGCCTTAAAGGTTTGCAAGGAACACATAGAATGGCTTAAGAAAATGAGAACTGATGTCGAAACTAGATTTTTTGATTTGTTTGATAAAAACTTAAAAATCAAAGAATGTTATGAGAGTTTGAAAAATGAAAATTATCTAATTAATTTAGAGATTTCACACTTGAAGGAATTTGTCCCTGTTCTGAGTTCCTTTGATATAAGATCAACCCCTTTGAAAGGATACAGATCTGAGATTGAAAAGATAAATAAAGAGAAAATTATTTTAAAGGAACAGATCTGTAGTCTTAAAAAGGAACTGGTTGTCGCAAGGAACAGAGGCAAAATCATGAAAGTTCCTAAGTGGATTGAGAAACCACAGACCAAAAGGAAGGAAGGTCTTGGTTTTGAAAACTACAAGAAAAGGAACAAGACAAAGAAATATGTTGATCTACCCAGTGATAAGTTCTGTATGTATTGTGGCAAGGTTGGAGTGAGGGGGAACAACACTTGGTATCTCGATAGTGGTTGTTCCAAGCACATGACAGGAGACAAAACGAAGTTTCTCTCACTCACAACCTATGAAGGTGGCAGTGTAACATTTGGTGATAATAAGAAAGGTAACATTGTTGCTATGGGTAAGGTCGTTGAAGGTCTAAAACATAATCTATTAAGCATATCTCAATTCTGTGACAAAGGAAATACTGTAAAATTTGATAAAGAAAAATGCTTAATCATCAACATTAAAACTAAGAAGGTTATTTTGGAAGGAACAAGGAAAGGGAACACATACATTGTGGATCTAGACCTTGTTCCTCAAATCAATTTAACTTGTCTTAGTGTTATTGAAGATGATTCACTTCTATGGCACAAGCGTCTAGGACATGCTAGCTTTTCGTTGCTTGAGAAACTTAGATCAAAAGACCTTGTTTTAGGATTACCATCTATAAAATTTCATATTGATCAAGTTTGTGATGCATGTGCACGAGGTAAACAAGTAAGATCCTCTTTCAAATCTAAAACGATTGTAAGTACCACTAAACCATTAGAGTTAATTCATATCGACTTATGTGGACCCATGAGAATTCAAAGCAGAAGTGGAAAGAGGTATGTACTTGTGATTGTAGATGACTACTCTAGGTACACTTGGGTTATTTTTCTCTCTAGTAAAGATGAAACTTATGATGAGTTCCTTGTCTTTGCTAAAAGAGTTCAAAACCTAAGTGGACATAAAATAATGCACATTAGATCAGATCATGGCAAGGAATTCGAAAATTATAAATTTGATGACCTAAGCAGAGATAATGGCCTAGATCATAATTTTTCTGCCCCTAGAACACCACAACAAAATGGTGTTGTAGAAAGGAAAAATAGAACTTTGGAGGAAATGTCTGGAACCATGTTAATTGCTAGTGAACTTCCAAGGAACTTTTGGGCTGAAGCTGTTAATACTGCTTGTCACATAATTAATCGTGCCATGATGAGACCTATCATTAATAAAACTCCTTATGAACTTTACTTTGGAAAGAAACCAAACATCACCTATTTTAGAACATTTGGATGCAAATGTTATGTGCATAATAATGGAAAAGATAATCTTGGAAAATTTGATGCAAGGAGTGATGAAGCAACATTTTTAGGATACTCCTCACATAGTAAAACTTATAGAGTATTTAACAAAAGAACTATGTGTGTTGAAGAAAGCATTCATGTAATCTTTGATGAATCTGACAAACATAATCCAAGCATACAGGTTGATGACTATGAGATAGGGTTGGCGCAACCTAGTCCAAGGAACACAGATTCACAAGAAGAAGAAGAAGTGAAAGAGGAAAGGAACGAGGAATTCGAAAATAATGAGAACAATGATATTCCTGTTCCTCAAGGAGGAGAAGATGCTCCTGTTCCTCTAAATGAAGGAACTGAGTCCACCGAGGCTAACAGAGGAACAACAGAGCAGAACTCCTCATCCACTCAAGGAACTCATGAGGAACAACATGTTCCTATAAGAGAGTTTCAACCAAAACCTTGGAGATTACAAAAGTCACATCCTGTGGAACTCATAATCAGCGACATATCCAAAGCTAGATTAGAAGCCATTAGAATCTTAATTGCATTTGCTGCTTACATGGGATTCAAATTATATCAAATGGATGTTAAGTGTGCATTTTTAAATGGCTATCTAAACGAAGATGTATATGTTGAACAACCCCCTGGTTTCGAAAATAACAATCTCCCAAATCATGTCTACAAGCTTGATAAAGCTCTTTATGGGTTAAAACAAGCACCTAGATCATGGTATGAGAGATTATCTAAGTTCCTTTTAGAAAACAACTTTAAAAGAGGAAAGGTTGATAAAACCTTGTTCCTAAAATCTAAAGGAACTGATATTTTGCTTGTTCAAATATATGTTGATGACATCATATTCGGAGCTACTAATGAAACATTGTGCAAAGAATTCTCAAGACTCGTGAGCAATGAATTTGAAATGAGTATGATGGGTGAGTTAAATTTCTTTCTTGGACTACAAATCAAACAAACTGAAAAAGGTATAATTGTTCACCAACAAAAATACATAAAGGAACTATTAAAGAAATATGGCCTCGAAAATTCAAAGATAAATCACACTCCTATGGGAACTTCAACTAGATTAGATGAAGACTCCATAGGAACAAGTGTTGATCAAACAAAATATAGAGGAATGATTGGTTTACTTTTGTATCTAACTGCTAGTCGTCCAGACATAGCTTTCAGTGTTGGTTTGTGTGCTAGATTTCAAGCAAATCCAAAGGAGTCTCACCTCACTGCTGTAAAGAGAATTCTTAGATACCTTAAAGGAACAGATGATCTTGGACTCTACTATCCAAGAAGTGATACATTCGAACTAAAAGGATATGCAGATGCAGATTATGCTGGAGATCTTGTAAATAGGAAAAGCACCTCAGGTATGGCACAATTCCTTGGTCATAGTTTAGTTTCTTGGAGTACCAAGAAACAAAACACAGTTGCTTTATCCACTGCTGAAGCAGAATATGTAGCTGCTGCTGCATGTTGCTCTCAAATGCTTTGGATAAAACAACAACTTAGTGACTATGGAATAAACTTTGAATGTGTTCCTATTTATTGTGACAATACAAGTGCTATCAGTATATCTAAAGATCCAGTGCATCACTCTAGAGTAAAGCATATACATATTAGACATCACTTTTTAAGAGAAAATGTCGAAAAAGGTTTGATTAAACTTGAGTTTTGTCAAACTGATTATCAGATTGCTGATATCCTAACTAAGCCTTTGCAAAGAGATAGATATGAAAAATTAAGGCTTGAGTTATGCTTAATAAAAATTAAGTGA


Protein sequences

Name Description Sequence
integrase integrase [Beta vulgaris].

MNTTEKLEEGYSTQRPPMFNGKYYNYWKNRMEIFIKAENYQVWRVIEVGDFEVTTTNDKNEVTLKPLSDYDKSDFEKMEVNAMAIKLLHCGLGPHEHNRIMGCKSAKQIWDLLEVTHEGTNEVKRSKIDLLMNQYELFCMKSKESIRDMFTRFTNIINELASLGKFISSEEQVRKVLRSLPKDRWMTKVTALQETKDFTKFNLEQLAGSLMTHELHLDTEYGESSKSKSIALKADDEDDSDSEEEEAALMVRKFRKMYRNMKNGNFKGKTKKFSNKAACHKCGSTDHFIKECPLWENDKTKERNKERFAERNKESKAPFSKANVRKAMIAAWGDSEMEEEEEQPTEETANLCLMANTDEKEDEEIIEVSQHGLESELDGKTRTEIYDLLYDAILECRDEREKREQTEQALKVCKEHIEWLKKMRTDVETRFFDLFDKNLKIKECYESLKNENYLINLEISHLKEFVPVLSSFDIRSTPLKGYRSEIEKINKEKIILKEQICSLKKELVVARNRGKIMKVPKWIEKPQTKRKEGLGFENYKKRNKTKKYVDLPSDKFCMYCGKVGVRGNNTWYLDSGCSKHMTGDKTKFLSLTTYEGGSVTFGDNKKGNIVAMGKVVEGLKHNLLSISQFCDKGNTVKFDKEKCLIINIKTKKVILEGTRKGNTYIVDLDLVPQINLTCLSVIEDDSLLWHKRLGHASFSLLEKLRSKDLVLGLPSIKFHIDQVCDACARGKQVRSSFKSKTIVSTTKPLELIHIDLCGPMRIQSRSGKRYVLVIVDDYSRYTWVIFLSSKDETYDEFLVFAKRVQNLSGHKIMHIRSDHGKEFENYKFDDLSRDNGLDHNFSAPRTPQQNGVVERKNRTLEEMSGTMLIASELPRNFWAEAVNTACHIINRAMMRPIINKTPYELYFGKKPNITYFRTFGCKCYVHNNGKDNLGKFDARSDEATFLGYSSHSKTYRVFNKRTMCVEESIHVIFDESDKHNPSIQVDDYEIGLAQPSPRNTDSQEEEEVKEERNEEFENNENNDIPVPQGGEDAPVPLNEGTESTEANRGTTEQNSSSTQGTHEEQHVPIREFQPKPWRLQKSHPVELIISDISKARLEAIRILIAFAAYMGFKLYQMDVKCAFLNGYLNEDVYVEQPPGFENNNLPNHVYKLDKALYGLKQAPRSWYERLSKFLLENNFKRGKVDKTLFLKSKGTDILLVQIYVDDIIFGATNETLCKEFSRLVSNEFEMSMMGELNFFLGLQIKQTEKGIIVHQQKYIKELLKKYGLENSKINHTPMGTSTRLDEDSIGTSVDQTKYRGMIGLLLYLTASRPDIAFSVGLCARFQANPKESHLTAVKRILRYLKGTDDLGLYYPRSDTFELKGYADADYAGDLVNRKSTSGMAQFLGHSLVSWSTKKQNTVALSTAEAEYVAAAACCSQMLWIKQQLSDYGINFECVPIYCDNTSAISISKDPVHHSRVKHIHIRHHFLRENVEKGLIKLEFCQTDYQIADILTKPLQRDRYEKLRLELCLIKIK

Domains

Domain Start-End Description Sequence

HMMPfam: PF13961
IPR025314
19-47 DUF4219
Domain of unknown function DUF4219

FNGKYYNYWKNRMEIFIKAENYQVWRVIE

HMMPfam: PF14223
104-219 UBN2,gag-polypeptide of LTR copia-type

KSAKQIWDLLEVTHEGTNEVKRSKIDLLMNQYELFCMKSKESIRDMFTRFTNIINELASLGKFISSEEQVRKVLRSLPKDRWMTKVTALQETKDFTKFNLEQLAGSLMTHELHLDT

Gene3D: G3DSA:4.10.60.10
IPR001878
268-294 Znf_CCH_retrovir
Zinc finger, CCHC-type

GKTKKFSNKAACHKCGSTDHFIKECPL

HMMSmart: SM00343
IPR001878
278-294 ZnF_C2HC
Zinc finger, CCHC-type

ACHKCGSTDHFIKECPL

ProfileScan: PS50158
IPR001878
279-293 ZF_CCHC
Zinc finger, CCHC-type

CHKCGSTDHFIKECP

Gene3D: G3DSA:4.10.60.10
IPR001878
552-564 Znf_CCH_retrovir
Zinc finger, CCHC-type

PSDKFCMYCGKVG

HMMPfam: PF13976
663-732 gag_pre-integrs,GAG-pre-integrase domain

TYIVDLDLVPQINLTCLSVIEDDSLLWHKRLGHASFSLLEKLRSKDLVLGLPSIKFHIDQVCDACARGKQ

superfamily: SSF53098
IPR012337
741-916 RNaseH_fold
Ribonuclease H-like domain

TIVSTTKPLELIHIDLCGPMRIQSRSGKRYVLVIVDDYSRYTWVIFLSSKDETYDEFLVFAKRVQNLSGHKIMHIRSDHGKEFENYKFDDLSRDNGLDHNFSAPRTPQQNGVVERKNRTLEEMSGTMLIASELPRNFWAEAVNTACHIINRAMMRPIINKTPYELYFGKKPNITYF

ProfileScan: PS50994
IPR001584
744-910 INTEGRASE
Integrase, catalytic core

STTKPLELIHIDLCGPMRIQSRSGKRYVLVIVDDYSRYTWVIFLSSKDETYDEFLVFAKRVQNLSGHKIMHIRSDHGKEFENYKFDDLSRDNGLDHNFSAPRTPQQNGVVERKNRTLEEMSGTMLIASELPRNFWAEAVNTACHIINRAMMRPIINKTPYELYFGKK

Gene3D: G3DSA:3.30.420.10
745-903 G3DSA:3.30.420.10

TTKPLELIHIDLCGPMRIQSRSGKRYVLVIVDDYSRYTWVIFLSSKDETYDEFLVFAKRVQNLSGHKIMHIRSDHGKEFENYKFDDLSRDNGLDHNFSAPRTPQQNGVVERKNRTLEEMSGTMLIASELPRNFWAEAVNTACHIINRAMMRPIINKTPY

HMMPfam: PF00665
IPR001584
745-863 rve
Integrase, catalytic core

TTKPLELIHIDLCGPMRIQSRSGKRYVLVIVDDYSRYTWVIFLSSKDETYDEFLVFAKRVQNLSGHKIMHIRSDHGKEFENYKFDDLSRDNGLDHNFSAPRTPQQNGVVERKNRTLEEM

HMMPanther: PTHR11439:SF128
806-1515 PTHR11439:SF128,SUBFAMILY NOT NAMED

NLSGHKIMHIRSDHGKEFENYKFDDLSRDNGLDHNFSAPRTPQQNGVVERKNRTLEEMSGTMLIASELPRNFWAEAVNTACHIINRAMMRPIINKTPYELYFGKKPNITYFRTFGCKCYVHNNGKDNLGKFDARSDEATFLGYSSHSKTYRVFNKRTMCVEESIHVIFDESDKHNPSIQVDDYEIGLAQPSPRNTDSQEEEEVKEERNEEFENNENNDIPVPQGGEDAPVPLNEGTESTEANRGTTEQNSSSTQGTHEEQHVPIREFQPKPWRLQKSHPVELIISDISKARLEAIRILIAFAAYMGFKLYQMDVKCAFLNGYLNEDVYVEQPPGFENNNLPNHVYKLDKALYGLKQAPRSWYERLSKFLLENNFKRGKVDKTLFLKSKGTDILLVQIYVDDIIFGATNETLCKEFSRLVSNEFEMSMMGELNFFLGLQIKQTEKGIIVHQQKYIKELLKKYGLENSKINHTPMGTSTRLDEDSIGTSVDQTKYRGMIGLLLYLTASRPDIAFSVGLCARFQANPKESHLTAVKRILRYLKGTDDLGLYYPRSDTFELKGYADADYAGDLVNRKSTSGMAQFLGHSLVSWSTKKQNTVALSTAEAEYVAAAACCSQMLWIKQQLSDYGINFECVPIYCDNTSAISISKDPVHHSRVKHIHIRHHFLRENVEKGLIKLEFCQTDYQIADILTKPLQRDRYEKLRLELCLIKI

HMMPanther: PTHR11439
806-1515 PTHR11439,GAG-POL-RELATED RETROTRANSPOSON

NLSGHKIMHIRSDHGKEFENYKFDDLSRDNGLDHNFSAPRTPQQNGVVERKNRTLEEMSGTMLIASELPRNFWAEAVNTACHIINRAMMRPIINKTPYELYFGKKPNITYFRTFGCKCYVHNNGKDNLGKFDARSDEATFLGYSSHSKTYRVFNKRTMCVEESIHVIFDESDKHNPSIQVDDYEIGLAQPSPRNTDSQEEEEVKEERNEEFENNENNDIPVPQGGEDAPVPLNEGTESTEANRGTTEQNSSSTQGTHEEQHVPIREFQPKPWRLQKSHPVELIISDISKARLEAIRILIAFAAYMGFKLYQMDVKCAFLNGYLNEDVYVEQPPGFENNNLPNHVYKLDKALYGLKQAPRSWYERLSKFLLENNFKRGKVDKTLFLKSKGTDILLVQIYVDDIIFGATNETLCKEFSRLVSNEFEMSMMGELNFFLGLQIKQTEKGIIVHQQKYIKELLKKYGLENSKINHTPMGTSTRLDEDSIGTSVDQTKYRGMIGLLLYLTASRPDIAFSVGLCARFQANPKESHLTAVKRILRYLKGTDDLGLYYPRSDTFELKGYADADYAGDLVNRKSTSGMAQFLGHSLVSWSTKKQNTVALSTAEAEYVAAAACCSQMLWIKQQLSDYGINFECVPIYCDNTSAISISKDPVHHSRVKHIHIRHHFLRENVEKGLIKLEFCQTDYQIADILTKPLQRDRYEKLRLELCLIKI

HMMPfam: PF07727
IPR013103
1095-1279 RVT_2
Reverse transcriptase, RNA-dependent DNA polymeras

ARLEAIRILIAFAAYMGFKLYQMDVKCAFLNGYLNEDVYVEQPPGFENNNLPNHVYKLDKALYGLKQAPRSWYERLSKFLLENNFKRGKVDKTLFLKSKGTDILLVQIYVDDIIFGATNETLCKEFSRLVSNEFEMSMMGELNFFLGLQIKQTEKGIIVHQQKYIKELLKKYGLENSKINHTPMG

superfamily: SSF56672
1114-1470 SSF56672

LYQMDVKCAFLNGYLNEDVYVEQPPGFENNNLPNHVYKLDKALYGLKQAPRSWYERLSKFLLENNFKRGKVDKTLFLKSKGTDILLVQIYVDDIIFGATNETLCKEFSRLVSNEFEMSMMGELNFFLGLQIKQTEKGIIVHQQKYIKELLKKYGLENSKINHTPMGTSTRLDEDSIGTSVDQTKYRGMIGLLLYLTASRPDIAFSVGLCARFQANPKESHLTAVKRILRYLKGTDDLGLYYPRSDTFELKGYADADYAGDLVNRKSTSGMAQFLGHSLVSWSTKKQNTVALSTAEAEYVAAAACCSQMLWIKQQLSDYGINFECVPIYCDNTSAISISKDPVHHSRVKHIHIRHHFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox