PRGDB00050111 (CK1)

From PRG Wiki
Jump to: navigation, search
CK1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121501692 (EF101866)
Gene Class Unknown
Domain Type
Gene Species Beta vulgaris

Comment?

Beta vulgaris RNA-directed DNA polymerase gene, partial cds; and heat stress transcription factor HSF, NPR1 (NPR1), hypothetical protein, integrase, hypothetical protein, retrotransposon proteins, hypothetical proteins, polynuclyotidyl transferase, transp

DNA Sequence

TTGAGCTTGGCAAGCGTTTCTTTCCACGCTGCTCCGATGTTCTTAATAAGATTATGGACGCCGAAGATCTATCACAGCTTGCATTTTTAGGAAAAGATACTCCAGAGGAACGGCAAAGGAAGAGAAAACGATACCTTGAACTGCAAGACGCTTTAACTAAGGCTTTTACAGAGGACAAAGAAGAGTTTGACCGTTCTACATTATCATCATCGTCGTCGTCGACTCCAATGGGGAGGCCATATGGTAAGACCAATTTCAAGAGGTAATTGCACTTGCTCGGTTGCTCTTTCCAATGGAAGCGAAAGTGGCTATGGATATTGCTCAAGTGGACGGAACTTCTGAATTCACATTGTCAAAGAATATAGCTGATGCACGAAGAAATGCGGTGGACTTGAATGAGGCTCCCTTTATATTGAAAGAGGAGCATTTGCAGAGGATGAAAGCACTGTCTAAAACTGAGGCACCTACTGGATATTCTTGACAAGATTGCACCAGATGACGTTCTAGTAGTGTTATCTGTCGCTGAGATGTGTGGAAATGCGTGTGACGGATTGCTGGCAAGGTGTATTGACAAGATTGTGAGGTCCGATATTGACGTAACCACCATTGATAAATCCTTGCCGCAGAATGTTGTGAAACAGATAATCGACACGCGAAAGGAACTTGGGTTTACTGAACCTGGGCGTGTTGAGTTTCCTGATAAGCATGTGAAGAGAATACACAGAGCTTTGGAATCCGATGATGTAGAGTTAGTCAGAATGCTTTTAAAAGAGCGCCATACAACTCTAGATGATGCATATGCCCTTCACTATGCTGTGGCACATTGTGATGCCAAGACCACCACGGAGCTTCTTGAGCTTGGGCTTGCAGATGTTAATCTTAGAAATCTAAGGGGTCACACTGTGCTACATGTGGCAGCCATGAGAAAAGAGCCTAAGATAATTGTATCCTTGTTAACCAAGGGAGCCCATCCGTCTGATATAACATCAGATGATAAAAAAGCACTGCAGATAGCAAAGAGACTAACAAAAGCTGTGGACTTCTATAAAACTACAGAACAAGGAAAAGATGCACCAAAGGATCGGTTGTGCATTGAAATACTGGAGCAAGCTGAAAGAAGAGAACCATTGCTAGGAGAAGGTTCTGTTTCTCTTGCAAAGGCAGGAGATGATCTGCGTATGAAGCTATTATATCTTGAAAATAGAGATGACAACCACCTCCACAACAATGGTGATCGATTCTCGCACCGCTTTCTCCGATTCCAACGACATCAGCAATGGCAGTAGCATCTGCTGCGTCGCCGCAACAACAACTACAACAACAACCGCCGCAGAAAACTCTCTCTCCTTTACTCCCGACGCCGCCGCTCTTCTCCGCCTCTCTGAAAACCTCGACTCGCTTTTCCAACCCTCGCTTTCTCTCTCCGACTCCGACTCTTTCGCCGACGCTAAAATCGTCGTTTCCGGTGATTCGCGTGAAGTCGCCGTTCATCGGTGTGTTCTCTCGTCTCGGAGCTCGTTCTTTCGGTCCGCTTTTGCTTCGAAACGAGAGAAGGAGAAGGAGAGGGATAAAGAGAGAGTGGTGAAGCTTGAGCTTAAGGATTTAGCTGGTGATTTTGAGGTTGGATTTGATTCGGTTGTTGCGGTTTTAGGTTATTTGTATAGTGGCAAAGTTAGGAATTTGCCTAGAGGAATTTGTGTTTGTGTTGATGAGGATTGCTCTCATGAAGCTTGTCGTCCTGCTGTTGATTTTGTTGTTGAGGTTCTCTATTTGTCTCACAAATTCGAGATTGTCGAATTGGTTTCGCTTTATCAG


Protein sequences

Name Description Sequence
NPR1 NPR1 [Beta vulgaris].

MTTTSTTMVIDSRTAFSDSNDISNGSSICCVAATTTTTTTAAENSLSFTPDAAALLRLSENLDSLFQPSLSLSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLLDILDKIAPDDVLVVLSVAEMCGNACDGLLARCIDKIVRSDIDVTTIDKSLPQNVVKQIIDTRKELGFTEPGRVEFPDKHVKRIHRALESDDVELVRMLLKERHTTLDDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIAKRLTKAVDFYKTTEQGKDAPKDRLCIEILEQAERREPLLGEGSVSLAKAGDDLRMKLLYLENRVALARLLFPMEAKVAMDIAQVDGTSEFTLSKNIADARRNAVDLNEAPFILKEEHLQRMKALSKTVELGKRFFPRCSDVLNKIMDAEDLSQLAFLGKDTPEERQRKRKRYLELQDALTKAFTEDKEEFDRSTLSSSSSSTPMGRPYGKTNFKR

NPR1 NPR1 [Beta vulgaris].

MTTTSTTMVIDSRTAFSDSNDISNGSSICCVAATTTTTTTAAENSLSFTPDAAALLRLSENLDSLFQPSLSLSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLLDILDKIAPDDVLVVLSVAEMCGNACDGLLARCIDKIVRSDIDVTTIDKSLPQNVVKQIIDTRKELGFTEPGRVEFPDKHVKRIHRALESDDVELVRMLLKERHTTLDDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIAKRLTKAVDFYKTTEQGKDAPKDRLCIEILEQAERREPLLGEGSVSLAKAGDDLRMKLLYLENRVALARLLFPMEAKVAMDIAQVDGTSEFTLSKNIADARRNAVDLNEAPFILKEEHLQRMKALSKTVELGKRFFPRCSDVLNKIMDAEDLSQLAFLGKDTPEERQRKRKRYLELQDALTKAFTEDKEEFDRSTLSSSSSSTPMGRPYGKTNFKR


Domains

Domain Start-End Description Sequence

superfamily: SSF54695
IPR011333
51-210 BTB/POZ_fold
BTB/POZ fold

DAAALLRLSENLDSLFQPSLSLSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLLDIL

superfamily: SSF54695
IPR011333
51-210 BTB/POZ_fold
BTB/POZ fold

DAAALLRLSENLDSLFQPSLSLSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLLDIL

Gene3D: G3DSA:3.30.710.10
IPR011333
62-207 BTB/POZ_fold
BTB/POZ fold

LDSLFQPSLSLSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLL

Gene3D: G3DSA:3.30.710.10
IPR011333
62-207 BTB/POZ_fold
BTB/POZ fold

LDSLFQPSLSLSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLL

HMMPfam: PF00651
IPR013069
72-207 BTB
BTB/POZ

LSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLL

HMMPfam: PF00651
IPR013069
72-207 BTB
BTB/POZ

LSDSDSFADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLL

HMMSmart: SM00225
IPR000210
79-210 BTB
BTB/POZ-like

ADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLLDIL

ProfileScan: PS50097
IPR000210
79-160 BTB
BTB/POZ-like

ADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLP

HMMSmart: SM00225
IPR000210
79-210 BTB
BTB/POZ-like

ADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLPRGICVCVDEDCSHEACRPAVDFVVEVLYLSHKFEIVELVSLYQRHLLDIL

ProfileScan: PS50097
IPR000210
79-160 BTB
BTB/POZ-like

ADAKIVVSGDSREVAVHRCVLSSRSSFFRSAFASKREKEKERDKERVVKLELKDLAGDFEVGFDSVVAVLGYLYSGKVRNLP

HMMPfam: PF11900
IPR024228
247-291 DUF3420
Domain of unknown function DUF3420

DIDVTTIDKSLPQNVVKQIIDTRKELGFTEPGRVEFPDKHVKRIH

HMMPfam: PF11900
IPR024228
247-291 DUF3420
Domain of unknown function DUF3420

DIDVTTIDKSLPQNVVKQIIDTRKELGFTEPGRVEFPDKHVKRIH

superfamily: SSF48403
IPR020683
290-391 ANK
Ankyrin repeat-containing domain

IHRALESDDVELVRMLLKERHTTLDDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIAKR

Gene3D: G3DSA:1.25.40.20
IPR020683
290-392 ANK
Ankyrin repeat-containing domain

IHRALESDDVELVRMLLKERHTTLDDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIAKRL

superfamily: SSF48403
IPR020683
290-391 ANK
Ankyrin repeat-containing domain

IHRALESDDVELVRMLLKERHTTLDDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIAKR

Gene3D: G3DSA:1.25.40.20
IPR020683
290-392 ANK
Ankyrin repeat-containing domain

IHRALESDDVELVRMLLKERHTTLDDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIAKRL

ProfileScan: PS50297
IPR020683
314-389 ANK_REP_REGION
Ankyrin repeat-containing domain

DDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIA

HMMSmart: SM00248
IPR002110
314-344 ANK
Ankyrin repeat

DDAYALHYAVAHCDAKTTTELLELGLADVNL

ProfileScan: PS50297
IPR020683
314-389 ANK_REP_REGION
Ankyrin repeat-containing domain

DDAYALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITSDDKKALQIA

HMMSmart: SM00248
IPR002110
314-344 ANK
Ankyrin repeat

DDAYALHYAVAHCDAKTTTELLELGLADVNL

HMMPfam: PF13637
318-360 Ank_4,Ankyrin repeats (many copies)

ALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRK

HMMPfam: PF13637
318-360 Ank_4,Ankyrin repeats (many copies)

ALHYAVAHCDAKTTTELLELGLADVNLRNLRGHTVLHVAAMRK

ProfileScan: PS50088
IPR002110
348-380 ANK_REPEAT
Ankyrin repeat

RGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITS

HMMSmart: SM00248
IPR002110
348-380 ANK
Ankyrin repeat

RGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITS

HMMSmart: SM00248
IPR002110
348-380 ANK
Ankyrin repeat

RGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITS

ProfileScan: PS50088
IPR002110
348-380 ANK_REPEAT
Ankyrin repeat

RGHTVLHVAAMRKEPKIIVSLLTKGAHPSDITS

HMMPfam: PF12313
IPR021094
390-591 NPR1_like_C
NPR1/NIM1-like, C-terminal

KRLTKAVDFYKTTEQGKDAPKDRLCIEILEQAERREPLLGEGSVSLAKAGDDLRMKLLYLENRVALARLLFPMEAKVAMDIAQVDGTSEFTLSKNIADARRNAVDLNEAPFILKEEHLQRMKALSKTVELGKRFFPRCSDVLNKIMDAEDLSQLAFLGKDTPEERQRKRKRYLELQDALTKAFTEDKEEFDRSTLSSSSSST

HMMPfam: PF12313
IPR021094
390-591 NPR1_like_C
NPR1/NIM1-like, C-terminal

KRLTKAVDFYKTTEQGKDAPKDRLCIEILEQAERREPLLGEGSVSLAKAGDDLRMKLLYLENRVALARLLFPMEAKVAMDIAQVDGTSEFTLSKNIADARRNAVDLNEAPFILKEEHLQRMKALSKTVELGKRFFPRCSDVLNKIMDAEDLSQLAFLGKDTPEERQRKRKRYLELQDALTKAFTEDKEEFDRSTLSSSSSST






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox