PRGDB00050112 (CK1)

From PRG Wiki
Jump to: navigation, search
CK1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 121501692 (EF101866)
Gene Class Unknown
Domain Type LRR
Gene Species Beta vulgaris

Comment?

Beta vulgaris RNA-directed DNA polymerase gene, partial cds; and heat stress transcription factor HSF, NPR1 (NPR1), hypothetical protein, integrase, hypothetical protein, retrotransposon proteins, hypothetical proteins, polynuclyotidyl transferase, transp

DNA Sequence

ATGGAACCCAAAACTGAGTTATCACTCGGTGGTGGAATCAGGAGTTCTGGGTTTGTTACAACTAAAATGGAGGATACAGAAGAAAAAGAAGTGATAGAGTTGCCAAAACCATTAGAAAATTTACATGAAATTGGACCACCCCCATTTTTAAGTAAGACATTTGAGATAGTAGAAGACCCAGAAACTGACACAATTGTTTCATGGGGTGTAACTTTTGATAGTTTCATTGTTTGGGATATCTCTAAGTTCTCTGATTTGCTTTCTAAGTATTTTAAGCATCGTAATTTCAACAGCTTTGTCCGTCAACTTAATACTTATGGATTCAGAAAAGTCCATCTTGATCGGTTGGAGTATGCAAATTCAGGGTTTCAAAAGGGTAAAAAGCATTTGTTGAAGACTATAAAAAGGAGAAACCATGGTGCAAACAACAATACTGCACTATTGCTCCAAAGAGAGACTGCAATAGAAAATATTAAGAAAGAACAGGAGGCGCTAAAGCTCGAGATCCTTGATCTTAAGAAAGAACAACAGAACTCGAACACGTGTTTGGCTGCATTGGGAGAGCGTGTGAAGTTCGTTGAATGGAAGCAACGTGAGTTCATTATGCTCATTGCCAAGGCAATGAAAAGAACTTCCTCATTTCAGCAGGTTCTCCAAAACTATAGGCACAACAAAGTTCTGAGTAGTGGAGAATTTTACAAGAAACGTAGATTGGCCTCAACTAGCGACAGTCTGGCACTGGCAGACCAGTTTCTGGCAAACAGTCCGACCACGACCCAAAATAAGGAAGATGTGTCTACTTTTCAGTATGAAGCAAACTCGTTTGTTGGGTCTGCGGGCCAAAAGTCGAACTTGGCATCCGAGACTAGTAGTCCAGATTTGTCTTCTGGAAGCTACATAATGTGGGAAAAGCTAATGGCAGATGATGTGATCTGTAAAGATGATAGGGAGGAGAAGTATGTCCATGAATTAGAGAATTTGATTACTAAACCATCCAGCTTGATTTGCAAATAA


Protein sequences

Name Description Sequence
heat stress transcription factor HSF heat stress transcription factor HSF [Beta vulgaris].

MEPKTELSLGGGIRSSGFVTTKMEDTEEKEVIELPKPLENLHEIGPPPFLSKTFEIVEDPETDTIVSWGVTFDSFIVWDISKFSDLLSKYFKHRNFNSFVRQLNTYGFRKVHLDRLEYANSGFQKGKKHLLKTIKRRNHGANNNTALLLQRETAIENIKKEQEALKLEILDLKKEQQNSNTCLAALGERVKFVEWKQREFIMLIAKAMKRTSSFQQVLQNYRHNKVLSSGEFYKKRRLASTSDSLALADQFLANSPTTTQNKEDVSTFQYEANSFVGSAGQKSNLASETSSPDLSSGSYIMWEKLMADDVICKDDREEKYVHELENLITKPSSLICK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10015
13-238 PTHR10015,HEAT SHOCK TRANSCRIPTION FACTOR

IRSSGFVTTKMEDTEEKEVIELPKPLENLHEIGPPPFLSKTFEIVEDPETDTIVSWGVTFDSFIVWDISKFSDLLSKYFKHRNFNSFVRQLNTYGFRKVHLDRLEYANSGFQKGKKHLLKTIKRRNHGANNNTALLLQRETAIENIKKEQEALKLEILDLKKEQQNSNTCLAALGERVKFVEWKQREFIMLIAKAMKRTSSFQQVLQNYRHNKVLSSGEFYKKRRL

HMMPanther: PTHR10015:SF7
13-238 PTHR10015:SF7,HEAT STRESS TRANSCRIPTION FACTOR

IRSSGFVTTKMEDTEEKEVIELPKPLENLHEIGPPPFLSKTFEIVEDPETDTIVSWGVTFDSFIVWDISKFSDLLSKYFKHRNFNSFVRQLNTYGFRKVHLDRLEYANSGFQKGKKHLLKTIKRRNHGANNNTALLLQRETAIENIKKEQEALKLEILDLKKEQQNSNTCLAALGERVKFVEWKQREFIMLIAKAMKRTSSFQQVLQNYRHNKVLSSGEFYKKRRL

superfamily: SSF46785
43-137 SSF46785

EIGPPPFLSKTFEIVEDPETDTIVSWGVTFDSFIVWDISKFSDLLSKYFKHRNFNSFVRQLNTYGFRKVHLDRLEYANSGFQKGKKHLLKTIKRR

HMMSmart: SM00415
IPR000232
45-137 HSF
Heat shock factor (HSF)-type, DNA-binding

GPPPFLSKTFEIVEDPETDTIVSWGVTFDSFIVWDISKFSDLLSKYFKHRNFNSFVRQLNTYGFRKVHLDRLEYANSGFQKGKKHLLKTIKRR

Gene3D: G3DSA:1.10.10.10
IPR011991
46-137 Wing_hlx_DNA_bd
Winged helix-turn-helix transcription repressor DN

PPPFLSKTFEIVEDPETDTIVSWGVTFDSFIVWDISKFSDLLSKYFKHRNFNSFVRQLNTYGFRKVHLDRLEYANSGFQKGKKHLLKTIKRR

FPrintScan: PR00056
IPR000232
49-72 HSFDOMAIN
Heat shock factor (HSF)-type, DNA-binding

FLSKTFEIVEDPETDTIVSWGVTF

HMMPfam: PF00447
IPR000232
49-139 HSF_DNA-bind
Heat shock factor (HSF)-type, DNA-binding

FLSKTFEIVEDPETDTIVSWGVTFDSFIVWDISKFSDLLSKYFKHRNFNSFVRQLNTYGFRKVHLDRLEYANSGFQKGKKHLLKTIKRRNH

FPrintScan: PR00056
IPR000232
86-98 HSFDOMAIN
Heat shock factor (HSF)-type, DNA-binding

LLSKYFKHRNFNS

PatternScan: PS00434
IPR000232
87-111 HSF_DOMAIN
Heat shock factor (HSF)-type, DNA-binding

LSKYFKHRNFNSFVRQLNTYGFRKV

FPrintScan: PR00056
IPR000232
99-111 HSFDOMAIN
Heat shock factor (HSF)-type, DNA-binding

FVRQLNTYGFRKV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox