PRGDB00050114 (RGA7)

From PRG Wiki
Jump to: navigation, search
RGA7
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 154845415 (EU036669)
Gene Class Unknown
Domain Type
Gene Species Lolium perenne

Comment?

Lolium perenne RGA7 gene, partial cds.

DNA Sequence

AGCAGTCAAGTTTCATCGTATGAGTGTATTAGCATAAATAGCTCTAACGTGAAGCACATACAAATACACCCCATGGTACGTTACTTGTCTATCACCGTGGATAACACAGACATTGAGAATAAACTATCTTTTGAAGATTATAATGAGAATTTGAGTGCACTAGGGAAGAGATTGAAGGTTGAGAACCTAAACACGTTAATGTTGTTTGGAGATTACCATGGAAGCTTTGCCAAAACTTTTGGTGCTTTGTTTAGGGAGGCTAATGCCATTCGCGCCATTTTCTTGTCCGGGGTGTCATATGATATGGATGATATATTCCACAACTTTGCAAAACTTGTCCATCTTCGCTACTTAAGGATCGGTATGTTGGATTACAGGACCATCTCCTTACCAAGTGCGTTAGTCAGATTGTATCATTTAACAGGTTATTGA


Protein sequences

Name Description Sequence
RGA7 RGA7 [Lolium perenne].

SSQVSSYECISINSSNVKHIQIHPMVRYLSITVDNTDIENKLSFEDYNENLSALGKRLKVENLNTLMLFGDYHGSFAKTFGALFREANAIRAIFLSGVSYDMDDIFHNFAKLVHLRYLRIGMLDYRTISLPSALVRLYHLTGY







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox