PRGDB00050118 (RGA3)

From PRG Wiki
Jump to: navigation, search
RGA3
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 154845407 (EU036665)
Gene Class N
Domain Type NBS
Gene Species Lolium perenne

Comment?

Lolium perenne RGA3 gene, partial cds.

DNA Sequence

GGCAAACGATTTCTCTTGGTACTAGATGATATCTGGTGCGATGAGGACGGCAATCAGCAGAAGTTGGAGAACTTACTTCCCCCTCTGAATTGTGGAAAGAAAGGAAGCATGATTCTAGCGACAAGTCGCAATAAAGATGCGTTTTCAGATCTAGGTCCTGGTGTGGCAGTGTCACGTAATATTTTTCCAATATCTGACTTGGATGGTGATGTCTTCTTGGAACTTTTCATGTATTATGCCCTTGATATTACAGTTCCAGATGATTCAGAACTAATGGAGCTCGAATGTATTGGGGCTAAAATTGCACCAAAGTTGAAAGGTTCACCATTCG


Protein sequences

Name Description Sequence
RGA3 RGA3 [Lolium perenne].

GKRFLLVLDDIWCDEDGNQQKLENLLPPLNCGKKGSMILATSRNKDAFSDLGPGVAVSRNIFPISDLDGDVFLELFMYYALDITVPDDSELMELECIGAKIAPKLKGSPF


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-99 SSF52540

GKRFLLVLDDIWCDEDGNQQKLENLLPPLNCGKKGSMILATSRNKDAFSDLGPGVAVSRNIFPISDLDGDVFLELFMYYALDITVPDDSELMELECIGA

HMMPfam: PF00931
IPR002182
2-109 NB-ARC,NBS
NB-ARC

KRFLLVLDDIWCDEDGNQQKLENLLPPLNCGKKGSMILATSRNKDAFSDLGPGVAVSRNIFPISDLDGDVFLELFMYYALDITVPDDSELMELECIGAKIAPKLKGSP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox