PRGDB00050120 (RGA1)

From PRG Wiki
Jump to: navigation, search
RGA1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 154845403 (EU036663)
Gene Class NL
Domain Type NBS, LRR
Gene Species Lolium perenne

Comment?

Lolium perenne RGA1 gene, partial cds.

DNA Sequence

GGGGGGATGGGGAAGACGACTTTCACACAACACATATATCAAGAAGTGAAGAGCTCGTTTGATGTTATGATTTGGATCTGTGTATCTCTCAATTTCGATGCAAACAGGTTAGCACAAGAGATTCTGAGACAGATCCCTGAAGTAAATGGTGAAAAGAAAAATGCCATTGAGGAAGAGCTTATCGAAGAAAGATTAAAACATAAGAGATTCTTGCTGGTCTTGGATGATGTCTGGACATATGAGGAGGATGAGTGGAAGAAACTGTTAGCTCCCTTCAGAAAAGGAGAGAGCAAGAGGCTAATATGGTTATTGTCACGACTCGAATCCCAGAGACA


Protein sequences

Name Description Sequence
RGA1 RGA1 [Lolium perenne].

GGMGKTTFTQHIYQEVKSSFDVMIWICVSLNFDANRLAQEILRQIPEVNGEKKNAIEEELIEERLKHKRFLLVLDDVWTYEEDEWKKLLAPFRKGESKRLIWLLSRLESQR


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-96 SSF52540

GGMGKTTFTQHIYQEVKSSFDVMIWICVSLNFDANRLAQEILRQIPEVNGEKKNAIEEELIEERLKHKRFLLVLDDVWTYEEDEWKKLLAPFRKGE

HMMPanther: PTHR11017
1-93 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGMGKTTFTQHIYQEVKSSFDVMIWICVSLNFDANRLAQEILRQIPEVNGEKKNAIEEELIEERLKHKRFLLVLDDVWTYEEDEWKKLLAPFR

HMMPfam: PF00931
IPR002182
1-108 NB-ARC,NBS
NB-ARC

GGMGKTTFTQHIYQEVKSSFDVMIWICVSLNFDANRLAQEILRQIPEVNGEKKNAIEEELIEERLKHKRFLLVLDDVWTYEEDEWKKLLAPFRKGESKRLIWLLSRLE

HMMPanther: PTHR11017:SF28
1-93 PTHR11017:SF28

GGMGKTTFTQHIYQEVKSSFDVMIWICVSLNFDANRLAQEILRQIPEVNGEKKNAIEEELIEERLKHKRFLLVLDDVWTYEEDEWKKLLAPFR

Gene3D: G3DSA:3.40.50.300
2-105 G3DSA:3.40.50.300

GMGKTTFTQHIYQEVKSSFDVMIWICVSLNFDANRLAQEILRQIPEVNGEKKNAIEEELIEERLKHKRFLLVLDDVWTYEEDEWKKLLAPFRKGESKRLIWLLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox