PRGDB00050212 (lectin receptor-like kinase Tg-28)

From PRG Wiki
Jump to: navigation, search
lectin receptor-like kinase Tg-28
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 151580038 (EF589827)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Musa acuminata

Comment?

Musa acuminata lectin receptor-like kinase Tg-28 gene, partial cds.

DNA Sequence

AGAGTGTACAAGGGCGTGTTACCGTCTTCTAGATCGGAGGTTGCAGTCAAACGAGTGTCCCATGGTTCAAGACAGGGTATGAGAGAGTTCATTGCAGAGATCGTCAGCCTCGGTCGCCTTCGCCACCGAAACCTCGTCCAATTGCTGGGCTACTGCCGACGCCAAGGAGAGCTTCTGTTAGTGTATGATTACATGCCCAATGGCAGTCTCGAAAAGTTCCTACACGATCAAGCTATGCCTACTCTGGATTGGGCGACGCGGTTCCGGATCATCAAAGGCGTGGCATCAGGGCTTCTGTATCTACACGAAGATTGGGAGCAAGTCGTCATCCACAGAGACATTAAGGCGAGCAACGTGTTGCTCGACAATGAATTGATTGGAAGGTTGGGTGACTTTGGCCTAGCAAGGTTGTACGACCATGGAACGGATCCACAGACCACCCATGTGGGGGGAACCATGGGTTATCTTGCTCCCGAGCTTGCTCGAACCGGCAAGGCGACCACCATCACCG


Protein sequences

Name Description Sequence
lectin receptor-like kinase Tg-28 lectin receptor-like kinase Tg-28 [Musa acuminata].

RVYKGVLPSSRSEVAVKRVSHGSRQGMREFIAEIVSLGRLRHRNLVQLLGYCRRQGELLLVYDYMPNGSLEKFLHDQAMPTLDWATRFRIIKGVASGLLYLHEDWEQVVIHRDIKASNVLLDNELIGRLGDFGLARLYDHGTDPQTTHVGGTMGYLAPELARTGKATTIT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-170 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RVYKGVLPSSRSEVAVKRVSHGSRQGMREFIAEIVSLGRLRHRNLVQLLGYCRRQGELLLVYDYMPNGSLEKFLHDQAMPTLDWATRFRIIKGVASGLLYLHEDWEQVVIHRDIKASNVLLDNELIGRLGDFGLARLYDHGTDPQTTHVGGTMGYLAPELARTGKATTIT

HMMPanther: PTHR24420:SF435
1-170 PTHR24420:SF435,SUBFAMILY NOT NAMED

RVYKGVLPSSRSEVAVKRVSHGSRQGMREFIAEIVSLGRLRHRNLVQLLGYCRRQGELLLVYDYMPNGSLEKFLHDQAMPTLDWATRFRIIKGVASGLLYLHEDWEQVVIHRDIKASNVLLDNELIGRLGDFGLARLYDHGTDPQTTHVGGTMGYLAPELARTGKATTIT

HMMPanther: PTHR24420
1-170 PTHR24420,FAMILY NOT NAMED

RVYKGVLPSSRSEVAVKRVSHGSRQGMREFIAEIVSLGRLRHRNLVQLLGYCRRQGELLLVYDYMPNGSLEKFLHDQAMPTLDWATRFRIIKGVASGLLYLHEDWEQVVIHRDIKASNVLLDNELIGRLGDFGLARLYDHGTDPQTTHVGGTMGYLAPELARTGKATTIT

superfamily: SSF56112
IPR011009
1-168 Kinase_like
Protein kinase-like domain

RVYKGVLPSSRSEVAVKRVSHGSRQGMREFIAEIVSLGRLRHRNLVQLLGYCRRQGELLLVYDYMPNGSLEKFLHDQAMPTLDWATRFRIIKGVASGLLYLHEDWEQVVIHRDIKASNVLLDNELIGRLGDFGLARLYDHGTDPQTTHVGGTMGYLAPELARTGKATT

Gene3D: G3DSA:3.30.200.20
1-52 G3DSA:3.30.200.20

RVYKGVLPSSRSEVAVKRVSHGSRQGMREFIAEIVSLGRLRHRNLVQLLGYC

HMMPfam: PF00069
IPR000719
2-165 Pkinase,Ser-thr
Protein kinase, catalytic domain

VYKGVLPSSRSEVAVKRVSHGSRQGMREFIAEIVSLGRLRHRNLVQLLGYCRRQGELLLVYDYMPNGSLEKFLHDQAMPTLDWATRFRIIKGVASGLLYLHEDWEQVVIHRDIKASNVLLDNELIGRLGDFGLARLYDHGTDPQTTHVGGTMGYLAPELARTGK

Gene3D: G3DSA:1.10.510.10
53-167 G3DSA:1.10.510.10

RRQGELLLVYDYMPNGSLEKFLHDQAMPTLDWATRFRIIKGVASGLLYLHEDWEQVVIHRDIKASNVLLDNELIGRLGDFGLARLYDHGTDPQTTHVGGTMGYLAPELARTGKAT

PatternScan: PS00108
IPR008271
109-121 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox