PRGDB00050214 (Pto resistance protein candidate Tg-65)

From PRG Wiki
Jump to: navigation, search
Pto resistance protein candidate Tg-65
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 151580034 (EF589825)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Musa acuminata

Comment?

Musa acuminata Pto resistance protein candidate Tg-65 gene, partial cds.

DNA Sequence

AAGGTCTACAAAGGTGTGCTCAGAGATGGTACCAAGATTGCTGTGAAGCGAGGCACCCGTGGGTCTCAACAAGGACTTGGGGAATTCCAAACAGAGATTGAGATCCTGTCTAAGATCCGCCATCACCACCTTGTTTCGCTGATCGGGTACTGTGAGGAGCAGGCAGAGAAGATCTTGGTCTATGAGTTTATGGAGAAGGGTCCCCTGAGAGACCATCTGTATGGCTCAAGGAATCCATCTTTATCTTGGAAACAACGGCTCGAGATTTGCATTGGCTCCGCGAGGGGCCTGCACTACTTGCACACTGGTTCTGCTCAAGTGATCATTCACCGCGATGTTAAATCCTCGAATATTTTGCTGGATGAAAACTACGCTGCCAAAGTTGCAGATTTTGGTCTGTCAAAATTAGGCACTTCAACCAACCAGTCTCATGTGAGCACCGGTGTCAAGGGAAGCTTTGGCTATCTCGATCCCGAGTACTTCAAGACACAGCAGCTCACCGAAAAGTCT


Protein sequences

Name Description Sequence
Pto resistance protein candidate Tg-65 Pto resistance protein candidate Tg-65 [Musa acuminata].

KVYKGVLRDGTKIAVKRGTRGSQQGLGEFQTEIEILSKIRHHHLVSLIGYCEEQAEKILVYEFMEKGPLRDHLYGSRNPSLSWKQRLEICIGSARGLHYLHTGSAQVIIHRDVKSSNILLDENYAAKVADFGLSKLGTSTNQSHVSTGVKGSFGYLDPEYFKTQQLTEKS

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-170 Kinase_like
Protein kinase-like domain

KVYKGVLRDGTKIAVKRGTRGSQQGLGEFQTEIEILSKIRHHHLVSLIGYCEEQAEKILVYEFMEKGPLRDHLYGSRNPSLSWKQRLEICIGSARGLHYLHTGSAQVIIHRDVKSSNILLDENYAAKVADFGLSKLGTSTNQSHVSTGVKGSFGYLDPEYFKTQQLTEKS

HMMPanther: PTHR24420
1-170 PTHR24420,FAMILY NOT NAMED

KVYKGVLRDGTKIAVKRGTRGSQQGLGEFQTEIEILSKIRHHHLVSLIGYCEEQAEKILVYEFMEKGPLRDHLYGSRNPSLSWKQRLEICIGSARGLHYLHTGSAQVIIHRDVKSSNILLDENYAAKVADFGLSKLGTSTNQSHVSTGVKGSFGYLDPEYFKTQQLTEKS

Gene3D: G3DSA:3.30.200.20
1-49 G3DSA:3.30.200.20

KVYKGVLRDGTKIAVKRGTRGSQQGLGEFQTEIEILSKIRHHHLVSLIG

HMMPanther: PTHR24420:SF785
1-170 PTHR24420:SF785

KVYKGVLRDGTKIAVKRGTRGSQQGLGEFQTEIEILSKIRHHHLVSLIGYCEEQAEKILVYEFMEKGPLRDHLYGSRNPSLSWKQRLEICIGSARGLHYLHTGSAQVIIHRDVKSSNILLDENYAAKVADFGLSKLGTSTNQSHVSTGVKGSFGYLDPEYFKTQQLTEKS

ProfileScan: PS50011
IPR000719
1-170 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KVYKGVLRDGTKIAVKRGTRGSQQGLGEFQTEIEILSKIRHHHLVSLIGYCEEQAEKILVYEFMEKGPLRDHLYGSRNPSLSWKQRLEICIGSARGLHYLHTGSAQVIIHRDVKSSNILLDENYAAKVADFGLSKLGTSTNQSHVSTGVKGSFGYLDPEYFKTQQLTEKS

HMMPfam: PF07714
IPR001245
1-170 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

KVYKGVLRDGTKIAVKRGTRGSQQGLGEFQTEIEILSKIRHHHLVSLIGYCEEQAEKILVYEFMEKGPLRDHLYGSRNPSLSWKQRLEICIGSARGLHYLHTGSAQVIIHRDVKSSNILLDENYAAKVADFGLSKLGTSTNQSHVSTGVKGSFGYLDPEYFKTQQLTEKS

Gene3D: G3DSA:1.10.510.10
50-170 G3DSA:1.10.510.10

YCEEQAEKILVYEFMEKGPLRDHLYGSRNPSLSWKQRLEICIGSARGLHYLHTGSAQVIIHRDVKSSNILLDENYAAKVADFGLSKLGTSTNQSHVSTGVKGSFGYLDPEYFKTQQLTEKS

PatternScan: PS00108
IPR008271
108-120 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox