PRGDB00050263 (SGT1)

From PRG Wiki
Jump to: navigation, search
SGT1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 109809922 (DQ656114)
Gene Class Unknown
Domain Type
Gene Species Begonia hybrid cultivar

Comment?

Begonia hybrid cultivar SGT1 (SGT1) mRNA, partial cds.

DNA Sequence

GATTGGGATAAATTGGAGGCGGAGGTGAAGAAAGAGGAGAAAGAAGAGAAGCTAGACGGTGATGCGGCTTTGAACAAGTTATTTAAAGACATCTACCAAAGTGCAGATGAGGACATGAGGAGAGCAATGAGCAAGTCTTTTGTGGAGTCGAATGGGACGGTGTTGTCGACGGACTGGAAGGAAGTGGGTTCAAAGAAGGTCGAAGGCAGTGCGCCTGACGGCATGGAGCTCAAAAAGTGG


Protein sequences

Name Description Sequence
SGT1 SGT1 [Begonia hybrid cultivar].

DWDKLEAEVKKEEKEEKLDGDAALNKLFKDIYQSADEDMRRAMSKSFVESNGTVLSTDWKEVGSKKVEGSAPDGMELKKW

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR22904
1-80 PTHR22904,TPR REPEAT CONTAINING PROTEIN

DWDKLEAEVKKEEKEEKLDGDAALNKLFKDIYQSADEDMRRAMSKSFVESNGTVLSTDWKEVGSKKVEGSAPDGMELKKW

HMMPanther: PTHR22904:SF69
1-80 PTHR22904:SF69,SUBFAMILY NOT NAMED

DWDKLEAEVKKEEKEEKLDGDAALNKLFKDIYQSADEDMRRAMSKSFVESNGTVLSTDWKEVGSKKVEGSAPDGMELKKW

HMMPfam: PF05002
IPR007699
1-80 SGS
SGS

DWDKLEAEVKKEEKEEKLDGDAALNKLFKDIYQSADEDMRRAMSKSFVESNGTVLSTDWKEVGSKKVEGSAPDGMELKKW

ProfileScan: PS51048
IPR007699
1-80 SGS
SGS

DWDKLEAEVKKEEKEEKLDGDAALNKLFKDIYQSADEDMRRAMSKSFVESNGTVLSTDWKEVGSKKVEGSAPDGMELKKW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox