PRGDB00050482 (NBS-LRR-like resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 120564794 (EF155650)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Saccharum officinarum

Comment?

Saccharum officinarum clone cRGA3-NCO376 NBS-LRR-like resistance protein mRNA, partial cds.

DNA Sequence

GGGGGGTGGGGGAAAACGACCCTTGTAACAAATGTTTATGAACGTGAAAAAATCAACTTTTCTGCTACAGCATGGATGGTTGTGTCCCAGACCTACACTATAGAAGCTCTGCTTAGGAAGTTACTCATGAAGGTTGGCGGTGAACAGCAGGTGTCACCTAACATCTACAAATTGGATGCCTATGATTTGAAAGAAAAAATAAAGCAAAAGCTCAAAACTAGGAAATGTTTGATTGTATTGGATGATGTCTGGGACCAGGAAGTGTACCTTCAAATGTCTGACGCATTCCAAAATCTTCAATCAAGTCGCATCATCATCACAACACGGAAGAATCATGTGGCTGCTCTTGCTCACCCAACACGTCGCCTTGATATCCAGCCTCTGGGAAATGCTCAGGCATTTGATCTCTTCTGCAGAAGGACTTTCTATAACGAGAAAGACCATGCATGCCCCAGTGACCTTGTGGAGGTTGCTACTTCTATAGTAGATAGGTGCCAGGGATTGCCACTAGCGTTG


Protein sequences

Name Description Sequence
NBS-LRR-like resistance protein NBS-LRR-like resistance protein [Saccharum officinarum].

GGWGKTTLVTNVYEREKINFSATAWMVVSQTYTIEALLRKLLMKVGGEQQVSPNIYKLDAYDLKEKIKQKLKTRKCLIVLDDVWDQEVYLQMSDAFQNLQSSRIIITTRKNHVAALAHPTRRLDIQPLGNAQAFDLFCRRTFYNEKDHACPSDLVEVATSIVDRCQGLPLAL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-172 SSF52540

GGWGKTTLVTNVYEREKINFSATAWMVVSQTYTIEALLRKLLMKVGGEQQVSPNIYKLDAYDLKEKIKQKLKTRKCLIVLDDVWDQEVYLQMSDAFQNLQSSRIIITTRKNHVAALAHPTRRLDIQPLGNAQAFDLFCRRTFYNEKDHACPSDLVEVATSIVDRCQGLPLAL

HMMPanther: PTHR23155
1-172 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGWGKTTLVTNVYEREKINFSATAWMVVSQTYTIEALLRKLLMKVGGEQQVSPNIYKLDAYDLKEKIKQKLKTRKCLIVLDDVWDQEVYLQMSDAFQNLQSSRIIITTRKNHVAALAHPTRRLDIQPLGNAQAFDLFCRRTFYNEKDHACPSDLVEVATSIVDRCQGLPLAL

HMMPfam: PF00931
IPR002182
1-172 NB-ARC,NBS
NB-ARC

GGWGKTTLVTNVYEREKINFSATAWMVVSQTYTIEALLRKLLMKVGGEQQVSPNIYKLDAYDLKEKIKQKLKTRKCLIVLDDVWDQEVYLQMSDAFQNLQSSRIIITTRKNHVAALAHPTRRLDIQPLGNAQAFDLFCRRTFYNEKDHACPSDLVEVATSIVDRCQGLPLAL

HMMPanther: PTHR23155:SF197
1-172 PTHR23155:SF197,OS11G0227100 PROTEIN

GGWGKTTLVTNVYEREKINFSATAWMVVSQTYTIEALLRKLLMKVGGEQQVSPNIYKLDAYDLKEKIKQKLKTRKCLIVLDDVWDQEVYLQMSDAFQNLQSSRIIITTRKNHVAALAHPTRRLDIQPLGNAQAFDLFCRRTFYNEKDHACPSDLVEVATSIVDRCQGLPLAL

Gene3D: G3DSA:3.40.50.300
2-110 G3DSA:3.40.50.300

GWGKTTLVTNVYEREKINFSATAWMVVSQTYTIEALLRKLLMKVGGEQQVSPNIYKLDAYDLKEKIKQKLKTRKCLIVLDDVWDQEVYLQMSDAFQNLQSSRIIITTRK

FPrintScan: PR00364
IPR000767
70-84 DISEASERSIST
Disease resistance protein

KLKTRKCLIVLDDVW

FPrintScan: PR00364
IPR000767
165-172 DISEASERSIST
Disease resistance protein

CQGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox