PRGDB00050483 (NBS-LRR-like resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 120564792 (EF155649)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Saccharum officinarum

Comment?

Saccharum officinarum clone cRGA2-NCO376 NBS-LRR-like resistance protein mRNA, partial cds.

DNA Sequence

GGGGGGTTGGGGAAAACGACCGTTGCAAGCAGTGTCTACAAGAACCAAAAGATCAGGAGAACTTTTGATTGTCATGCATGGGTTACTGTATCTCAGACTTACCAAGTTGAAGAGCTTCTGAGAGAAATCATGAATCAGTTAACAGAGCAGAGAGCGAGTTTGGCAAGTGGCTTCATGACCGTGAGTCGCATGAGATTAGTTGAGATAATACAGAGCTATTTGCGGGACAAAAAATATTTCATTGTCTTGGATGATGTATGGGAGAAAGATGCTTGGTCATTTCTAAACTATGCATTTGTCAAAAAAAATTGTGGAAGTAAAGTTCTGATAACAACCCGGAGAAAAGATGTGTCTTCTTTGGCAGTTCACAATCGTGTAATTGAACTTAAAACTCTTAACTATGCTGAATCATGGGAACTCTTCTGCAAAAAGGCGTTTTTTGCATTGGAGGACAACATATGTCCTAAGAATCTCACATCTTTGGCGGAGAAAATTGTTGATAGGTGTCAAGGATTGCCACTAGCGTTA


Protein sequences

Name Description Sequence
NBS-LRR-like resistance protein NBS-LRR-like resistance protein [Saccharum officinarum].

GGLGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTVSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLAEKIVDRCQGLPLAL

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-176 NB-ARC,NBS
NB-ARC

GGLGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTVSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLAEKIVDRCQGLPLAL

HMMPanther: PTHR11017:SF20
1-176 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GGLGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTVSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLAEKIVDRCQGLPLAL

superfamily: SSF52540
1-176 P-loop containing nucleoside triphosphate hydrolases

GGLGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTVSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLAEKIVDRCQGLPLAL

HMMPanther: PTHR11017
1-176 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGLGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTVSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLAEKIVDRCQGLPLAL

FPrintScan: PR00364
IPR000767
73-87 DISEASERSIST
Disease resistance protein

YLRDKKYFIVLDDVW

FPrintScan: PR00364
IPR000767
169-176 DISEASERSIST
Disease resistance protein

CQGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox