PRGDB00050485 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 118562886 (AB263748)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Ipomoea trifida

Comment?

Ipomoea trifida DNA, self-incompatibility (S-) locus region, haplotype:S1.

DNA Sequence

GCTGCAAATTGGGTCCAAAATTTCCAAAATGGCTGCAAACTCAGAGTGGCTTCTCTGAGCTTGATATCTCCAGTACTGGCATTTCTGATACAATGCCTAACTGGTTTTGGGACCTGTGTTCCAAAGTTGAATACTTGGCCTTATCCAACAACAAGATTGATGGTGAACTGCCTGATTTGTCAACCAAGTTTGGTGTTTTTCCAGAAATTGATCTTAGCCATAACAATTTCAGGGGTCCAATACACTCACTCCCTCCAAAAGTAAAATCCCTCTATCTCTCAAACAATAGTTTTGTGGGTTCCATTTCTTTTGTGTGCAGAGTTCTCAAATTTATGTCTATAGACCTCTCGGATAATCAATTCTCTGGAGAGATTCCCGATTGCTGGCATCACCTCTCACGTCTGAACAATCTCAATCTTGCAAACAATAATTTCTCTGGGAAAGTTCCTCCCTCTTTTGGGTATCTGTATTATCTCAAAGAATTGCAATTGAGAAACAACAACTTCACTGGAGAATTGCCATCCTCATTGCAGAACTGCACATTACTGAGAATTTTAGATTTGGGGAGAAATCAGCTCACAGGGAGAGTCCCATCATGGTTTGGAACATCTCTAGTGGACTTGATCATTGTTAACCTCAGAGAGAACCAGTTCCATGGAGAGCTTCCTCTGAGTTTGTGTCATCTTAACGACATTCATGTGTTGGATCTTTCTCAAAACAGAATTTCTGGGAAGATTCCACATTGCTTTAGCAACTTCACATATTTGAGTTTGACAAACAGTTCCCTCGGAACCACTGTAGCAAGTAAAGCATATTTTGTCTTCCAAAATGACATTGATTCCTACAAATCCAACATTTTGATTCAGTGGAAATACAATGAGCGGGAATATAGTGGCCGATTGAGACTACTGAAATTGATTGATCTTTCAAGCAATCTACTGGGAGGAGATATTCCTGAAGAATTTTCTAGTCTTCACGGATTAATTTCCTTGAACCTATCAAGAAACCATTTGACCGGGAAAATCATCCGGGAAATAGGCCAGATGGAGATGTTAGAATCTCTTGATTTGTCTTATAATCAACTTTCTGGTGAAATTCCAATAAGTTTGGGTCGTTTGAGTTTTCTTCAAATTCTTGAGTTGTCCAACAACAACTTGTCCGGGAAAATTCCATCAAGCACTCAAATGCAGAGTTTCAATGCATCTTCTTATGCCCACAACAGTGGACTGTGCGGTGATCCACTGCCCAAGTGTCCTAGAAATGTTCCAAACAAAGACGAAGATGAAGATGATGATGATGGGCTTATCACGCAGGGGTTTTACATATCAATGGTCCTGGGGTTCTCTCTTAGCTTCTGGGGATTTCTTGTCATTTTTTTCTTCAAAGGCTCATGGAGAAATGCCAGGACATCAGAGACTGAGTTTATGTCATGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Ipomoea trifida].

CKLGPKFPKWLQTQSGFSELDISSTGISDTMPNWFWDLCSKVEYLALSNNKIDGELPDLSTKFGVFPEIDLSHNNFRGPIHSLPPKVKSLYLSNNSFVGSISFVCRVLKFMSIDLSDNQFSGEIPDCWHHLSRLNNLNLANNNFSGKVPPSFGYLYYLKELQLRNNNFTGELPSSLQNCTLLRILDLGRNQLTGRVPSWFGTSLVDLIIVNLRENQFHGELPLSLCHLNDIHVLDLSQNRISGKIPHCFSNFTYLSLTNSSLGTTVASKAYFVFQNDIDSYKSNILIQWKYNEREYSGRLRLLKLIDLSSNLLGGDIPEEFSSLHGLISLNLSRNHLTGKIIREIGQMEMLESLDLSYNQLSGEIPISLGRLSFLQILELSNNNLSGKIPSSTQMQSFNASSYAHNSGLCGDPLPKCPRNVPNKDEDEDDDDGLITQGFYISMVLGFSLSFWGFLVIFFFKGSWRNARTSETEFMS


Domains

Domain Start-End Description Sequence

superfamily: SSF52047
1-142 SSF52047,LRR

CKLGPKFPKWLQTQSGFSELDISSTGISDTMPNWFWDLCSKVEYLALSNNKIDGELPDLSTKFGVFPEIDLSHNNFRGPIHSLPPKVKSLYLSNNSFVGSISFVCRVLKFMSIDLSDNQFSGEIPDCWHHLSRLNNLNLANN

Gene3D: G3DSA:3.80.10.10
1-82 G3DSA:3.80.10.10

CKLGPKFPKWLQTQSGFSELDISSTGISDTMPNWFWDLCSKVEYLALSNNKIDGELPDLSTKFGVFPEIDLSHNNFRGPIHS

HMMPanther: PTHR24420
45-466 PTHR24420,FAMILY NOT NAMED

LALSNNKIDGELPDLSTKFGVFPEIDLSHNNFRGPIHSLPPKVKSLYLSNNSFVGSISFVCRVLKFMSIDLSDNQFSGEIPDCWHHLSRLNNLNLANNNFSGKVPPSFGYLYYLKELQLRNNNFTGELPSSLQNCTLLRILDLGRNQLTGRVPSWFGTSLVDLIIVNLRENQFHGELPLSLCHLNDIHVLDLSQNRISGKIPHCFSNFTYLSLTNSSLGTTVASKAYFVFQNDIDSYKSNILIQWKYNEREYSGRLRLLKLIDLSSNLLGGDIPEEFSSLHGLISLNLSRNHLTGKIIREIGQMEMLESLDLSYNQLSGEIPISLGRLSFLQILELSNNNLSGKIPSSTQMQSFNASSYAHNSGLCGDPLPKCPRNVPNKDEDEDDDDGLITQGFYISMVLGFSLSFWGFLVIFFFKGSWRN

HMMPanther: PTHR24420:SF473
45-466 PTHR24420:SF473,SUBFAMILY NOT NAMED

LALSNNKIDGELPDLSTKFGVFPEIDLSHNNFRGPIHSLPPKVKSLYLSNNSFVGSISFVCRVLKFMSIDLSDNQFSGEIPDCWHHLSRLNNLNLANNNFSGKVPPSFGYLYYLKELQLRNNNFTGELPSSLQNCTLLRILDLGRNQLTGRVPSWFGTSLVDLIIVNLRENQFHGELPLSLCHLNDIHVLDLSQNRISGKIPHCFSNFTYLSLTNSSLGTTVASKAYFVFQNDIDSYKSNILIQWKYNEREYSGRLRLLKLIDLSSNLLGGDIPEEFSSLHGLISLNLSRNHLTGKIIREIGQMEMLESLDLSYNQLSGEIPISLGRLSFLQILELSNNNLSGKIPSSTQMQSFNASSYAHNSGLCGDPLPKCPRNVPNKDEDEDDDDGLITQGFYISMVLGFSLSFWGFLVIFFFKGSWRN

Gene3D: G3DSA:3.80.10.10
83-264 G3DSA:3.80.10.10

LPPKVKSLYLSNNSFVGSISFVCRVLKFMSIDLSDNQFSGEIPDCWHHLSRLNNLNLANNNFSGKVPPSFGYLYYLKELQLRNNNFTGELPSSLQNCTLLRILDLGRNQLTGRVPSWFGTSLVDLIIVNLRENQFHGELPLSLCHLNDIHVLDLSQNRISGKIPHCFSNFTYLSLTNSSLGT

superfamily: SSF52058
112-418 SSF52058,LRR

SIDLSDNQFSGEIPDCWHHLSRLNNLNLANNNFSGKVPPSFGYLYYLKELQLRNNNFTGELPSSLQNCTLLRILDLGRNQLTGRVPSWFGTSLVDLIIVNLRENQFHGELPLSLCHLNDIHVLDLSQNRISGKIPHCFSNFTYLSLTNSSLGTTVASKAYFVFQNDIDSYKSNILIQWKYNEREYSGRLRLLKLIDLSSNLLGGDIPEEFSSLHGLISLNLSRNHLTGKIIREIGQMEMLESLDLSYNQLSGEIPISLGRLSFLQILELSNNNLSGKIPSSTQMQSFNASSYAHNSGLCGDPLPKCP

HMMPfam: PF00560
IPR001611
134-155 LRR_1
Leucine-rich repeat

LNNLNLANNNFSGKVPPSFGYL

HMMPfam: PF12799
158-193 LRR_4,Leucine Rich repeats (2 copies)

LKELQLRNNNFTGELPSSLQNCTLLRILDLGRNQLT

HMMPfam: PF00560
IPR001611
232-251 LRR_1
Leucine-rich repeat

HVLDLSQNRISGKIPHCFSN

Gene3D: G3DSA:3.80.10.10
298-413 G3DSA:3.80.10.10

GRLRLLKLIDLSSNLLGGDIPEEFSSLHGLISLNLSRNHLTGKIIREIGQMEMLESLDLSYNQLSGEIPISLGRLSFLQILELSNNNLSGKIPSSTQMQSFNASSYAHNSGLCGDP

HMMPfam: PF13516
327-347 LRR_6,Leucine Rich repeat

LISLNLSRNHLTGKIIREIGQ

HMMPfam: PF00560
IPR001611
351-372 LRR_1
Leucine-rich repeat

LESLDLSYNQLSGEIPISLGRL

FPrintScan: PR00019
351-364 LEURICHRPT,Leucine-rich repeat signature

LESLDLSYNQLSGE

FPrintScan: PR00019
372-385 LEURICHRPT,Leucine-rich repeat signature

LSFLQILELSNNNL

HMMPfam: PF00560
IPR001611
375-392 LRR_1
Leucine-rich repeat

LQILELSNNNLSGKIPSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox