PRGDB00050487 (NBS-LRR-like resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 117935870 (EF059976)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Saccharum officinarum

Comment?

Saccharum officinarum clone RGA4-NCO376 NBS-LRR-like resistance protein gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACTTTGGCTCAAAAAGTATACAATCGCCAAAAAATAAAAGGAACTTTTAGCATACAAGCCTGGATTTGTGTTTCTAAAGAGTACTCTGATGACACCCTTTTGAAAGAAGTTCTACGGAATATTGGTGTAGATTATAAGCAAGACGAAACTGCTGGAGAGCTTAGCATAAAGCTTGCGGCAGCAGTTCAAAATAAAACTGTATTTCTTGTGCTAGATGACATTTGGAAGCATGAGGCATGGACTAATCTACTAAGAACTCCATTAAACACTTCATCTACAGCAATGATTCTTGTGACTACTCGTAATGATATAGTGGCACGAGCAATTGGTGTGCAAGATGTTCATCGAGTAGAATTGATGTCTGATGACACAGGATGGGAGTTGATGTGGAAAAGTATGAACATTAATGAAGAGACCGAAGTGGAAAATCTAAGGGATACGGGGAATGAGATTATCCGTATGTGTGGTGGCCTCCCCCTAGCCCT


Protein sequences

Name Description Sequence
NBS-LRR-like resistance protein NBS-LRR-like resistance protein [Saccharum officinarum].

GGVGKTTLAQKVYNRQKIKGTFSIQAWICVSKEYSDDTLLKEVLRNIGVDYKQDETAGELSIKLAAAVQNKTVFLVLDDIWKHEAWTNLLRTPLNTSSTAMILVTTRNDIVARAIGVQDVHRVELMSDDTGWELMWKSMNINEETEVENLRDTGNEIIRMCGGLPLAL

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-168 SSF52540

GGVGKTTLAQKVYNRQKIKGTFSIQAWICVSKEYSDDTLLKEVLRNIGVDYKQDETAGELSIKLAAAVQNKTVFLVLDDIWKHEAWTNLLRTPLNTSSTAMILVTTRNDIVARAIGVQDVHRVELMSDDTGWELMWKSMNINEETEVENLRDTGNEIIRMCGGLPLAL

HMMPanther: PTHR23155
1-160 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAQKVYNRQKIKGTFSIQAWICVSKEYSDDTLLKEVLRNIGVDYKQDETAGELSIKLAAAVQNKTVFLVLDDIWKHEAWTNLLRTPLNTSSTAMILVTTRNDIVARAIGVQDVHRVELMSDDTGWELMWKSMNINEETEVENLRDTGNEIIRM

HMMPfam: PF00931
IPR002182
1-168 NB-ARC,NBS
NB-ARC

GGVGKTTLAQKVYNRQKIKGTFSIQAWICVSKEYSDDTLLKEVLRNIGVDYKQDETAGELSIKLAAAVQNKTVFLVLDDIWKHEAWTNLLRTPLNTSSTAMILVTTRNDIVARAIGVQDVHRVELMSDDTGWELMWKSMNINEETEVENLRDTGNEIIRMCGGLPLAL

HMMPanther: PTHR23155:SF121
1-160 PTHR23155:SF121,SUBFAMILY NOT NAMED

GGVGKTTLAQKVYNRQKIKGTFSIQAWICVSKEYSDDTLLKEVLRNIGVDYKQDETAGELSIKLAAAVQNKTVFLVLDDIWKHEAWTNLLRTPLNTSSTAMILVTTRNDIVARAIGVQDVHRVELMSDDTGWELMWKSMNINEETEVENLRDTGNEIIRM

Gene3D: G3DSA:3.40.50.300
2-113 G3DSA:3.40.50.300

GVGKTTLAQKVYNRQKIKGTFSIQAWICVSKEYSDDTLLKEVLRNIGVDYKQDETAGELSIKLAAAVQNKTVFLVLDDIWKHEAWTNLLRTPLNTSSTAMILVTTRNDIVAR

FPrintScan: PR00364
IPR000767
67-81 DISEASERSIST
Disease resistance protein

AVQNKTVFLVLDDIW

FPrintScan: PR00364
IPR000767
161-168 DISEASERSIST
Disease resistance protein

CGGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox