PRGDB00050489 (NBS-LRR-like resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR-like resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 117935866 (EF059974)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Saccharum officinarum

Comment?

Saccharum officinarum clone RGA2-NCO376 NBS-LRR-like resistance protein gene, partial cds.

DNA Sequence

ATGGGGAAAACGACCGTTGCAAGCAGTGTCTACAAGAACCAAAAGATCAGGAGAACTTTTGATTGTCATGCATGGGTTACTGTATCTCAGACTTACCAAGTTGAAGAGCTTCTGAGAGAAATCATGAATCAGTTAACAGAGCAGAGAGCAAGTTTGGCAAGTGGCTTCATGACCATGAGTCGCATGAGATTAGTTGAGATAATACAGAGCTATTTGCGGGACAAAAAATATTTCATTGTCTTGGATGATGTATGGGAGAAAGATGCTTGGTCATTTCTAAACTATGCATTTGTCAAAAAAAATTGTGGAAGTAAAGTTCTGATAACAACCCGGAGAAAAGATGTGTCTTCTTTGGCAGTTCACAATCGTGTAATTGAACTTAAAACTCTTAACTATGCTGAATCATGGGAACTCTTCTGCAAAAAGGCGTTTTTTGCATTGGAGGACAACATATGTCCTAAGAATCTCACATCTTTGGTGGAGAAAATTGTTGATAAGTGTCAAGGATTGCCACTAGCGTTG


Protein sequences

Name Description Sequence
NBS-LRR-like resistance protein NBS-LRR-like resistance protein [Saccharum officinarum].

MGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTMSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLVEKIVDKCQGLPLAL

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-174 NB-ARC,NBS
NB-ARC

MGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTMSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLVEKIVDKCQGLPLAL

superfamily: SSF52540
1-174 SSF52540

MGKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTMSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLVEKIVDKCQGLPLAL

HMMPanther: PTHR11017
2-174 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTMSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLVEKIVDKCQGLPLAL

HMMPanther: PTHR11017:SF20
2-174 PTHR11017:SF20,SUBFAMILY NOT NAMED

GKTTVASSVYKNQKIRRTFDCHAWVTVSQTYQVEELLREIMNQLTEQRASLASGFMTMSRMRLVEIIQSYLRDKKYFIVLDDVWEKDAWSFLNYAFVKKNCGSKVLITTRRKDVSSLAVHNRVIELKTLNYAESWELFCKKAFFALEDNICPKNLTSLVEKIVDKCQGLPLAL

FPrintScan: PR00364
IPR000767
71-85 DISEASERSIST
Disease resistance protein

YLRDKKYFIVLDDVW

FPrintScan: PR00364
IPR000767
167-174 DISEASERSIST
Disease resistance protein

CQGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox