PRGDB00050493 (60I2G15)

From PRG Wiki
Jump to: navigation, search
60I2G15
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 40644186 (AJ416708)
Gene Class Unknown
Domain Type
Gene Species Populus deltoides

Comment?

Populus deltoides MER locus, genomic DNA, cultivar S9-2.

DNA Sequence

ATGAAATCAACAGCACGTCGTCAGAAGACGGTTGCAGCTAGTTCTTCTAGCAGCGAGGAGGACGTATCCTTAGGTGCTGATCACGGCGAGGAATCTACGCCAACTTGTGATGCTGCCTCTTCTAGCGCGGTTTCACAGCGCAGAAGCGGTGTGCCTTCACAGCGGGGTCAATTCACCCGCAAGTACCAAGCACAATGGAAGGATGACCTCTCAATGTTCACAAACATTGAGGCTGCAAGGACTATAACATTGGCGTTTAAATCGTCGATGGAGATTCCATTGTTTCAATGGAGCCAGGTTTCCAAACATCCTGAGTGGAAACCTAATATCGATGCATGGTTTAAGCGATTTCAGAACAAATTTGAGTGGGATAGGGCGGACAACAATGTTGTGAGGAGGGTATGGGAGAATCACGCGGCAACTAGGTTGCGTGATTTTTGGTATGACACCCAAAAAAAATCAAAAAGACATGCGAGGGATAACGGTCTTGAAGGATGGAATGAGGTGGCGGTTTGGCAGGAATTCAAACCGCCATTCATCTCGGGGGAAATATGGACGGCATATATTGAGCACGTGACCTCAGAGCGGTTCTCACGGTGCTCACATTCTGGCGCCGACAACCGGAACTGGCAAATTCATGGTTCGGTGACGACGCACACTGGCGGATCCGTCCCATTCAGCGCACATGCAAAGCGGATGGCTGCGTCTCTTGGACGTGAACCGAGTCCAATGGAGCTGTTTCTAGAGACGCATGTGCGGAGTCAAGACCGCCAAAAGGGGGTGCAGCAGTTCGTGGACAACCGTGCTCAGCACTTCGTGGAGACCTATAATAGCCGGTTGAGGGAGAGATATGGGGACAATCCGTCGACCCATCCAGATTTCGATCCAGATTTGTGGATGGAGGCGGGATCGTCTGGTGGACCCGATAAAAACAGGGTCTACGGGCTCTCCAACACTACGGCTGACAACTTGCGTTCGACTCGTAGTGTCTCAACTGTTGGAAGCTCTCCATCAGTATCGAACACCCAGTCTGAGGAGTTCATTGCGTTGAAACAACAATATCAACAACTCTCGACGAATTATGATGAGCTCCGTCAAATAGTCATGGAGATGAGATCAAAGATGGGTGACGATACTTGTGCAGCATCTTTTTGGCCGTATGGTCCCGGGAACAACCAGCCTCCTCCTCCTCCTCCGCCTCCTCCTCCAGCTCCGCCGCTATTCTAG



Domains

Domain Start-End Description Sequence

HMMPfam: PF03004
IPR004252
183-316 Transposase_24
Transposase, Ptta/En/Spm, plant

EIWTAYIEHVTSERFSRCSHSGADNRNWQIHGSVTTHTGGSVPFSAHAKRMAASLGREPSPMELFLETHVRSQDRQKGVQQFVDNRAQHFVETYNSRLRERYGDNPSTHPDFDPDLWMEAGSSGGPDKNRVYGL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox