PRGDB00050494 (F2G14_230)

From PRG Wiki
Jump to: navigation, search
F2G14_230
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 9755655 (AL391146)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 5, BAC clone F2G14 (ESSA project).

DNA Sequence

ATTTTCCTGGTTTTTAGAAAAGGTTCTGCACTTGGGAAGCTTGTGGTGACCTCTGGTCTCTTACATAGCTCATGGAGTAAGATCTTGGAGATACATAACCCACCTTATTCGAATCATGATCCAGGTCTACAAGTTTCAAAAAAAAAAAAAGATTCAGGTCTAGAATTTCAGATTCACCGAGAAGAGAAATTCACACTTGTGGTTTTTAGCGCACCACCGATCTGCAGAAGTAGTAGCTCTGATTCTACTCTTCTTCATGTGAAAGATAAAGAAAATCCTTTCCCATTCCTCTGCTCCGAGAACAACCCATCATTCTCTCTTCACACACCTGCTTTTAACCTTTTTACCTCTGCTTCTACTAGTCTCACTTACCTCAAATCAGAGTTGCTCCAAACGCTCAAGTCTGAGAAACCGGTGATCATCACCGGAGCTGCGTTAGGAGGGTCTGTTGCATCTCTCTATACGCTATGGCTTCTTGAAACCATCGAACCGACGTTAAAACGTCCCTTATGCATCACATTTGGCTCGCCATTGATCGGAGACGCTTCTCTTCAACAGATTCTTGAGAACTCTGTGAGGAATTCATGTTTCCTTCACGTTGTATCAGCACAAACTCGTATCAAGATGGACTTCTTCAAACCTTTTGGAACGTTTTTGATCTGTTTTGATTCCGGATGTGTTTGCATCGAGGACCATGTGGCGGTCACAGAGTTGCTAAACGGTGTTCATGATTCGGGTCTAGTAGACTACAGCCAAGTTCTAAATCGTCTTGACCAATCCATGTTGTCTCTGGCGGATTCAAGATTGATCCCTGAAGATGTTATCAAAGGAATAGAGAAACGTGCAGAAATGAAAAATCTGCGATTTGATATGATGTTTAAGAAACTAAACGACATGAAGATATCGATGGCTTATATAGAGTGGTACAAAAAGAAATGCAAGGAGGTCAAGATCGGTTACTACGATCGGTTCAAGACTCAGCTCGCGTTTCCGTCGAAAGAGTTTGATATAAACATCAAGAATCACCACAAATCAGAGCTAAACCGTTTTTGGAAATCAGTAGTTGAAGAAGTAGAGAGGAGGCCGCAGAGCGATGCATCGATTCTCAAGAGACGGTTTCTATTCTCGGGGAACAATTACAGACGGATGATCGAACCACTCGATATTGCTGAATATTACCTCGAGGGTCGGAAAGAGTATCGAACTACGGGAAGGTCTCACCACTATGTTATGCTTGAGAAATGGTTTGGAATGGAATCGATATTAATAGAAAAGGAAAGATGCAAAAAGAGAGATTTGAGTGATCTTTTGACGTTTGATTCTTGTTTTTGGGCTGAAGTTGAGGATTCGTTGATTGTAATTAATCAGTTGAATACAACTGTGGGGATGAGAGACGATGTGAGAGAGGTATTGACTAGAAAACTCGTGGAGTTTGAGGGATACGTGTGGGAGATAATCACAAAACGTGAGGTTTCGCCGGAGATATTCTTAGAGGAAAGCAGTTTCATGAAGTGGTGGAAAGAGTACAAAAAGATCAAAGGCTTTAATTCTTCATACTTGACCGAGTTTATGAACACCCGGAAGTACGAGAGTTATGGGTGGTATGATGAAGTTTACATCAATCGCAACAACTCTTAG


Protein sequences

Name Description Sequence
putative protein (fragment) putative protein (fragment) [Arabidopsis thaliana].

IFLVFRKGSALGKLVVTSGLLHSSWSKILEIHNPPYSNHDPGLQVSKKKKDSGLEFQIHREEKFTLVVFSAPPICRSSSSDSTLLHVKDKENPFPFLCSENNPSFSLHTPAFNLFTSASTSLTYLKSELLQTLKSEKPVIITGAALGGSVASLYTLWLLETIEPTLKRPLCITFGSPLIGDASLQQILENSVRNSCFLHVVSAQTRIKMDFFKPFGTFLICFDSGCVCIEDHVAVTELLNGVHDSGLVDYSQVLNRLDQSMLSLADSRLIPEDVIKGIEKRAEMKNLRFDMMFKKLNDMKISMAYIEWYKKKCKEVKIGYYDRFKTQLAFPSKEFDINIKNHHKSELNRFWKSVVEEVERRPQSDASILKRRFLFSGNNYRRMIEPLDIAEYYLEGRKEYRTTGRSHHYVMLEKWFGMESILIEKERCKKRDLSDLLTFDSCFWAEVEDSLIVINQLNTTVGMRDDVREVLTRKLVEFEGYVWEIITKREVSPEIFLEESSFMKWWKEYKKIKGFNSSYLTEFMNTRKYESYGWYDEVYINRNNS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.1820
84-202 G3DSA:3.40.50.1820

LLHVKDKENPFPFLCSENNPSFSLHTPAFNLFTSASTSLTYLKSELLQTLKSEKPVIITGAALGGSVASLYTLWLLETIEPTLKRPLCITFGSPLIGDASLQQILENSVRNSCFLHVVS

HMMPfam: PF01764
IPR002921
113-202 Lipase_3
Lipase, class 3

NLFTSASTSLTYLKSELLQTLKSEKPVIITGAALGGSVASLYTLWLLETIEPTLKRPLCITFGSPLIGDASLQQILENSVRNSCFLHVVS

superfamily: SSF53474
128-204 SSF53474

ELLQTLKSEKPVIITGAALGGSVASLYTLWLLETIEPTLKRPLCITFGSPLIGDASLQQILENSVRNSCFLHVVSAQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox