PRGDB00050501 (T16L24.290)

From PRG Wiki
Jump to: navigation, search
T16L24.290
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6899943 (AL138659)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 3, BAC clone T16L24.

DNA Sequence

ATGGCTGTCAAAATACTACCATCTTCTTCTTCTGCTTCTTCTTCCTTAGTATTCATCATGTCCTTGTTCTTTCTACTTCTTTCACTTATTGTCCCTTCATCAGTTCTATCAGCCACTCTTCGATCTGATATTCAAGCTCTAGAGTCTATAATACGCAGCGTTGATCCAAGTTCCATCTCTCCATCCTCTTACCTCAGCACATGGGACTTCTCTGAAGACCCGTGTGAAGGCTCAGGGACGTTCTTGGGAGTTATGTGTTCTTTCCCTCTGGAGAACACAACTAGCCGGGTTATAGAGATCGATCTTGATGATGACGGTTATGACGGTTTCCTCTCTGATGAAGTAGGAAACCTAACTGAGCTCACTGTCCTTAGCCTCAACAAAAACAGATTCCGCGGTCCAGTACCAGAATCTGTGTTCCAGCTCCGGAAACTTACCAAACTCTCACTAGCAGAAAATTTCTTCACTGGAGACATACCAGCAGAAATCACGCGGCTCAAGGAGCTCAAAACCATCGACCTGTCGAAAAACAGTATCGCCGGTGAAATCCCTCCAAGGATCTCAGCCTTGAGAAGTTTGACTCACCTGGTCCTATCAAACAACCATCTCGATGGAAGAATACCTGCGCTCAACGGCTTGTGGAAGCTACAAGTATTAGAACTCGGTAACAATCATCTTTATGGAATGCTTCCTAAGCTTCCCCCAAGTCTAAGAACTCTATCACTCTGTTTCAATAGCCTTGCAGGACGTATATCACCCTTGCATAGGCTAAAACAGCTTGTGTCTTTAGATGTGAGCCAGAACAGATTCTCAGGCACCGTTGGCCATGAAATCCTAACATTCCCTGAGATTGCACGCATCAATGTGTCTTTTAACCAGTTCATATCCATAGAGGTTATTAAAGTTACAGGATCACGCCTGCGCATGCTTGATGCTGAAGGAAACCATTTACAGGGGCACCTTCCGCTGAACCTGGCAACTTATGAAAACCTAAAGGATATCAATCTACGGAGCAACATGTTCTCTGGCGATATTCCTAGGATTTATGGGAAAAGACTGGAGAATTCATGGAGAAGCTTATACTTGGAGAACAACTACCTGTCAGGTATACTTCCTGAGGAGTTTCAAAAGATTACCAAACAGATCAGAGGAAACCTATCGAACAACTGTCTGCAATGTCCTAAGAATGTTCAAATCTGCCAAGGAACACAAAAGCCAAAATCACAATGCACCAATGCAATGCTGGGGAGCTTGGAGTAG


Protein sequences

Name Description Sequence
putative protein putative protein [Arabidopsis thaliana].

MAVKILPSSSSASSSLVFIMSLFFLLLSLIVPSSVLSATLRSDIQALESIIRSVDPSSISPSSYLSTWDFSEDPCEGSGTFLGVMCSFPLENTTSRVIEIDLDDDGYDGFLSDEVGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSLAENFFTGDIPAEITRLKELKTIDLSKNSIAGEIPPRISALRSLTHLVLSNNHLDGRIPALNGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRFSGTVGHEILTFPEIARINVSFNQFISIEVIKVTGSRLRMLDAEGNHLQGHLPLNLATYENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGILPEEFQKITKQIRGNLSNNCLQCPKNVQICQGTQKPKSQCTNAMLGSLE


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
18-392 PTHR24420,FAMILY NOT NAMED

FIMSLFFLLLSLIVPSSVLSATLRSDIQALESIIRSVDPSSISPSSYLSTWDFSEDPCEGSGTFLGVMCSFPLENTTSRVIEIDLDDDGYDGFLSDEVGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSLAENFFTGDIPAEITRLKELKTIDLSKNSIAGEIPPRISALRSLTHLVLSNNHLDGRIPALNGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRFSGTVGHEILTFPEIARINVSFNQFISIEVIKVTGSRLRMLDAEGNHLQGHLPLNLATYENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGILPEEFQKITKQIRGNLSNNCLQ

HMMPfam: PF08263
IPR013210
42-87 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SDIQALESIIRSVDPSSISPSSYLSTWDFSEDPCEGSGTFLGVMCS

superfamily: SSF52058
42-405 SSF52058,LRR

SDIQALESIIRSVDPSSISPSSYLSTWDFSEDPCEGSGTFLGVMCSFPLENTTSRVIEIDLDDDGYDGFLSDEVGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSLAENFFTGDIPAEITRLKELKTIDLSKNSIAGEIPPRISALRSLTHLVLSNNHLDGRIPALNGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRFSGTVGHEILTFPEIARINVSFNQFISIEVIKVTGSRLRMLDAEGNHLQGHLPLNLATYENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGILPEEFQKITKQIRGNLSNNCLQCPKNVQICQGTQK

Gene3D: G3DSA:3.80.10.10
42-287 G3DSA:3.80.10.10

SDIQALESIIRSVDPSSISPSSYLSTWDFSEDPCEGSGTFLGVMCSFPLENTTSRVIEIDLDDDGYDGFLSDEVGNLTELTVLSLNKNRFRGPVPESVFQLRKLTKLSLAENFFTGDIPAEITRLKELKTIDLSKNSIAGEIPPRISALRSLTHLVLSNNHLDGRIPALNGLWKLQVLELGNNHLYGMLPKLPPSLRTLSLCFNSLAGRISPLHRLKQLVSLDVSQNRFSGTVGHEILTFPEIARI

ProfileScan: PS51450
IPR001611
144-166 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTKLSLAENFFTGDIPAEITRL

ProfileScan: PS51450
IPR001611
168-191 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELKTIDLSKNSIAGEIPPRISALR

HMMPfam: PF12799
168-204 LRR_4,Leucine Rich repeats (2 copies)

ELKTIDLSKNSIAGEIPPRISALRSLTHLVLSNNHLD

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTHLVLSNNHLDGRIPALNGLW

ProfileScan: PS51450
IPR001611
215-234 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLELGNNHLYGMLPKLP

ProfileScan: PS51450
IPR001611
236-258 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRTLSLCFNSLAGRISPLHRLK

ProfileScan: PS51450
IPR001611
259-280 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLVSLDVSQNRFSGTVGHEILT

Gene3D: G3DSA:3.80.10.10
288-396 G3DSA:3.80.10.10

NVSFNQFISIEVIKVTGSRLRMLDAEGNHLQGHLPLNLATYENLKDINLRSNMFSGDIPRIYGKRLENSWRSLYLENNYLSGILPEEFQKITKQIRGNLSNNCLQCPKN

ProfileScan: PS51450
IPR001611
306-327 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLRMLDAEGNHLQGHLPLNLAT

ProfileScan: PS51450
IPR001611
330-352 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKDINLRSNMFSGDIPRIYGKR

ProfileScan: PS51450
IPR001611
356-377 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SWRSLYLENNYLSGILPEEFQK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox