PRGDB00050502 (T4D2.220)

From PRG Wiki
Jump to: navigation, search
T4D2.220
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6434245 (AL132958)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 3, BAC clone T4D2.

DNA Sequence

ATGGACTTTGGCCTAACATGGATTATAATGATGATGATATTGTTACAGGGATGTAGAAGCTGCATTGAAAGTGAAAGGCAGGGTTTGTTGGAGATCAAGGCTTATATTATCTCGGTTATTACTGATCCACATTTAGACATTCGTCGAGGATGGATGAGTAGTGATCGGTCTTGTTGCCATTGGAGAAGAATCAAGTGCGACATCACCAGCAAACGCAGCTTCAGAGTCTCAACTTGTCGTCGGGGTACTTCAAAGGCTGGTTCGACGAAAGAAAAGGGCCTGGGAAGTTTAAGAAATCTTGAGACTCTGGATCTCGGTGTCAACTTTTACGATACCAGTGTCTTGCCATACTTGAATGAGGCTGTGTCGCTCAAGACTTTGATTCTCCATGACAACTTATTTAAGGGTGGCTTTCCTGTTCAAGAACTAATAAATCTGACAAGTTTGGAAGTACTAGATCTGAAATTCAACAAGTTCAGTGGCCAGTTACCAACACAAGAGCTCACTAATCTGCGAAACCTCAGAGCCTTGGATCTAAGCAATAATAAATTCTCTGGAATTTGTAGATTAGAGCAGTTGCAAGAGCTTCGTCTTAGTCGAAACAGATTTGAGGGTGAAATCCCACTCTGTTTTTCGAGATTCTCCAAACTCCGAGTTCTTGATCTATCATCAAATCACCTAAGTGGGAAGATTCCATATTTCATCAGTGACTTCAAATCCATGGAATACTTATCACTTCTCGATAATGACTTTGAAGGCTTGTTCTCGTTGGGTTTGATCACTGAATTAACAGAGCTCAAGGTTTTTAAACTCTCTTCCAGGTCTGGTATGCTGCAAATAGTAGAGACTAACGTTTCCGGTGGTCTGCAATCGCAGCTAAGTAGTATTATGTTGTCACACTGCAACCTTGGAAAAATCCCTGGTTTTCTTTGGTATCAGCAGGAATTGCGGGTCATCGATCTCTCCAACAATATATTATCCGGAGTGTTCCCCACTTGGCTGCTGGAAAATAACACAGAGCTTCAGGCCCTGTTGTTACAGAACAACTCATTCAAAACACTTACACTTCCAAGAACCATGCGCAGGCTGCAGATTTTGGATCTTTCGGTGAATAATTTCAACAATCAACTCCCTAAGGATGTCGGTTTGATACTTGCGAGCTTGAGACATTTGAATCTCTCAAACAATGAGTTTCTAGGGAACATGCCCTCCTCTATGGCCAGGATGGAAAATATTGAATTTATGGACCTATCTTACAACAACTTCTCAGGGAAATTGCCAAGGAATCTTTTCACAGGTTGCTACTCATTGAGTTGGCTTAAGCTCTCGCACAACAGATTCAGTGGCCCGATTATTCGGAAATCGAGTGATGAGACCTCTTTGATTACGCTGATCATGGACAATAACATGTTTACAGGGAAGATCCCTCGTACTCTACTCAACTTAAGGATGTTGAGTGTGATCGACTTATCAAACAACTTACTCACTGGTACAATTCCAAGGTGGTTAGGCAATTTCTTTTTGGAAGTTCTGAGGATCTCCAACAACCGTCTACAAGGTGCCATACCACCGTCTTTGTTCAACATTCCTTACCTCTGGCTCTTGGACCTTTCTGGAAACTTCTTGTCGGGTAGCTTACCCCTGCGGTCCAGCTCAGATTACGGTTATATATTGGACTTGCACAACAACAATCTCACTGGATCTATTCCAGACACGTTGTGGTACGGGCTACGGTTGCTTGATCTGAGAAACAACAAACTGTCTGGAAACATTCCACTGTTCAGGAGCACCCCGAGCATCAGTGTTGTTCTGTTGAGAGAGAATAACTTGACAGGAAAGATTCCTGTTGAGCTGTGCGGTTTAAGCAACGTAAGGATGTTGGATTTTGCTCACAATCGATTGAATGAATCCATACCTTCGTGTGTCACCAATCTATCATTTGGCTCAGGAGGACATAGTAATGCTGATTCAGATTGGTATCCGGCGAGCTTGCTCTCAAACTTTATGGAGATATACACCGAAGTATATTACGAGTCTTTGATTGTGTCAGATCGGTTTTCTCTAGACTACTCGGTAGATTTTAATGTCCAAGTTGAATTTGCGGTGAAACAGAGATATGACTTGTACATGAGAGGAACTCTTAACCAGATGTTTGGCCTGGATCTGTCGAGCAACGAGTTAAGTGGTAATATCCCAGAAGAGCTAGGAGATCTTAAGAGAGTACGCTCGCTGAATCTCTCACGCAATTCATTATCGGGTTCTATACCTGGAAGCTTCTCCAACCTAAGAAGCATAGAGAGCTTGGATCTTTCTTTCAACAAGTTGCATGGAACCATTCCCTCACAACTCACATTGTTGCAATCTCTTGTCGTCTTTAACGTGTCATACAACAATCTCTCAGGTGTGATTCCGCAAGGAAAACAGTTCAACACCTTTGGTGAGAAGAGTTACTTAGGTAATTTTCTTCTCTGTGGATCACCCACCAAAAGAAGCTGTGGTGGTACCACAATCAGCTCAGGAAAAGAATATGAAGATGACGATGAAAGTGGATTACTCGATATTGTGGTATTGTGGTGGAGCCTCGGGACGACCTACGTAACGGTTATGATGGGGTTTTTGGTGTTTCTCTGCTTTGATTCTCCATGGCGCCGAGCATGGTTCTGCCTTGTTGATACTTTTATCGACCGCGTAAAAGATGTACTGGGAGTTATCTAG


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Arabidopsis thaliana].

MDFGLTWIIMMMILLQGCRSCIESERQGLLEIKAYIISVITDPHLDIRRGWMSSDRSCCHWRRIKCDITSKRSFRVSTCRRGTSKAGSTKEKGLGSLRNLETLDLGVNFYDTSVLPYLNEAVSLKTLILHDNLFKGGFPVQELINLTSLEVLDLKFNKFSGQLPTQELTNLRNLRALDLSNNKFSGICRLEQLQELRLSRNRFEGEIPLCFSRFSKLRVLDLSSNHLSGKIPYFISDFKSMEYLSLLDNDFEGLFSLGLITELTELKVFKLSSRSGMLQIVETNVSGGLQSQLSSIMLSHCNLGKIPGFLWYQQELRVIDLSNNILSGVFPTWLLENNTELQALLLQNNSFKTLTLPRTMRRLQILDLSVNNFNNQLPKDVGLILASLRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYSLSWLKLSHNRFSGPIIRKSSDETSLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNLLTGTIPRWLGNFFLEVLRISNNRLQGAIPPSLFNIPYLWLLDLSGNFLSGSLPLRSSSDYGYILDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPLFRSTPSISVVLLRENNLTGKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGSGGHSNADSDWYPASLLSNFMEIYTEVYYESLIVSDRFSLDYSVDFNVQVEFAVKQRYDLYMRGTLNQMFGLDLSSNELSGNIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKLHGTIPSQLTLLQSLVVFNVSYNNLSGVIPQGKQFNTFGEKSYLGNFLLCGSPTKRSCGGTTISSGKEYEDDDESGLLDIVVLWWSLGTTYVTVMMGFLVFLCFDSPWRRAWFCLVDTFIDRVKDVLGVI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-886 PTHR24420,FAMILY NOT NAMED

MDFGLTWIIMMMILLQGCRSCIESERQGLLEIKAYIISVITDPHLDIRRGWMSSDRSCCHWRRIKCDITSKRSFRVSTCRRGTSKAGSTKEKGLGSLRNLETLDLGVNFYDTSVLPYLNEAVSLKTLILHDNLFKGGFPVQELINLTSLEVLDLKFNKFSGQLPTQELTNLRNLRALDLSNNKFSGICRLEQLQELRLSRNRFEGEIPLCFSRFSKLRVLDLSSNHLSGKIPYFISDFKSMEYLSLLDNDFEGLFSLGLITELTELKVFKLSSRSGMLQIVETNVSGGLQSQLSSIMLSHCNLGKIPGFLWYQQELRVIDLSNNILSGVFPTWLLENNTELQALLLQNNSFKTLTLPRTMRRLQILDLSVNNFNNQLPKDVGLILASLRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYSLSWLKLSHNRFSGPIIRKSSDETSLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNLLTGTIPRWLGNFFLEVLRISNNRLQGAIPPSLFNIPYLWLLDLSGNFLSGSLPLRSSSDYGYILDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPLFRSTPSISVVLLRENNLTGKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGSGGHSNADSDWYPASLLSNFMEIYTEVYYESLIVSDRFSLDYSVDFNVQVEFAVKQRYDLYMRGTLNQMFGLDLSSNELSGNIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKLHGTIPSQLTLLQSLVVFNVSYNNLSGVIPQGKQFNTFGEKSYLGNFLLCGSPTKRSCGGTTISSGKEYEDDDESGLLDIVVLWWSLGTTYVTVMMGFLVFLCFDSPWRRAW

HMMPanther: PTHR24420:SF473
1-886 PTHR24420:SF473,SUBFAMILY NOT NAMED

MDFGLTWIIMMMILLQGCRSCIESERQGLLEIKAYIISVITDPHLDIRRGWMSSDRSCCHWRRIKCDITSKRSFRVSTCRRGTSKAGSTKEKGLGSLRNLETLDLGVNFYDTSVLPYLNEAVSLKTLILHDNLFKGGFPVQELINLTSLEVLDLKFNKFSGQLPTQELTNLRNLRALDLSNNKFSGICRLEQLQELRLSRNRFEGEIPLCFSRFSKLRVLDLSSNHLSGKIPYFISDFKSMEYLSLLDNDFEGLFSLGLITELTELKVFKLSSRSGMLQIVETNVSGGLQSQLSSIMLSHCNLGKIPGFLWYQQELRVIDLSNNILSGVFPTWLLENNTELQALLLQNNSFKTLTLPRTMRRLQILDLSVNNFNNQLPKDVGLILASLRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYSLSWLKLSHNRFSGPIIRKSSDETSLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNLLTGTIPRWLGNFFLEVLRISNNRLQGAIPPSLFNIPYLWLLDLSGNFLSGSLPLRSSSDYGYILDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPLFRSTPSISVVLLRENNLTGKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGSGGHSNADSDWYPASLLSNFMEIYTEVYYESLIVSDRFSLDYSVDFNVQVEFAVKQRYDLYMRGTLNQMFGLDLSSNELSGNIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKLHGTIPSQLTLLQSLVVFNVSYNNLSGVIPQGKQFNTFGEKSYLGNFLLCGSPTKRSCGGTTISSGKEYEDDDESGLLDIVVLWWSLGTTYVTVMMGFLVFLCFDSPWRRAW

HMMPfam: PF08263
IPR013210
23-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ESERQGLLEIKAYIISVITDPHLDIRRGWMSSDRSCCHWRRIKCD

Gene3D: G3DSA:3.80.10.10
44-267 G3DSA:3.80.10.10

HLDIRRGWMSSDRSCCHWRRIKCDITSKRSFRVSTCRRGTSKAGSTKEKGLGSLRNLETLDLGVNFYDTSVLPYLNEAVSLKTLILHDNLFKGGFPVQELINLTSLEVLDLKFNKFSGQLPTQELTNLRNLRALDLSNNKFSGICRLEQLQELRLSRNRFEGEIPLCFSRFSKLRVLDLSSNHLSGKIPYFISDFKSMEYLSLLDNDFEGLFSLGLITELTELK

superfamily: SSF52047
92-399 SSF52047,LRR

KGLGSLRNLETLDLGVNFYDTSVLPYLNEAVSLKTLILHDNLFKGGFPVQELINLTSLEVLDLKFNKFSGQLPTQELTNLRNLRALDLSNNKFSGICRLEQLQELRLSRNRFEGEIPLCFSRFSKLRVLDLSSNHLSGKIPYFISDFKSMEYLSLLDNDFEGLFSLGLITELTELKVFKLSSRSGMLQIVETNVSGGLQSQLSSIMLSHCNLGKIPGFLWYQQELRVIDLSNNILSGVFPTWLLENNTELQALLLQNNSFKTLTLPRTMRRLQILDLSVNNFNNQLPKDVGLILASLRHLNLSNNEFL

ProfileScan: PS51450
IPR001611
99-119 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLETLDLGVNFYDTSVLPYLN

ProfileScan: PS51450
IPR001611
123-144 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLILHDNLFKGGFPVQELI

HMMPfam: PF12799
147-187 LRR_4,Leucine Rich repeats (2 copies)

TSLEVLDLKFNKFSGQLPTQELTNLRNLRALDLSNNKFSGI

ProfileScan: PS51450
IPR001611
148-169 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLDLKFNKFSGQLPTQELT

ProfileScan: PS51450
IPR001611
173-194 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRALDLSNNKFSGICRLEQLQ

FPrintScan: PR00019
174-187 LEURICHRPT,Leucine-rich repeat signature

LRALDLSNNKFSGI

HMMPfam: PF12799
192-228 LRR_4,Leucine Rich repeats (2 copies)

QLQELRLSRNRFEGEIPLCFSRFSKLRVLDLSSNHLS

ProfileScan: PS51450
IPR001611
216-238 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNHLSGKIPYFISDF

Gene3D: G3DSA:3.80.10.10
268-371 G3DSA:3.80.10.10

VFKLSSRSGMLQIVETNVSGGLQSQLSSIMLSHCNLGKIPGFLWYQQELRVIDLSNNILSGVFPTWLLENNTELQALLLQNNSFKTLTLPRTMRRLQILDLSVN

ProfileScan: PS51450
IPR001611
292-313 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLSSIMLSHCNLGKIPGFLWYQ

ProfileScan: PS51450
IPR001611
315-336 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRVIDLSNNILSGVFPTWLLE

ProfileScan: PS51450
IPR001611
340-361 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQALLLQNNSFKTLTLPRTMR

ProfileScan: PS51450
IPR001611
362-384 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQILDLSVNNFNNQLPKDVGLI

Gene3D: G3DSA:3.80.10.10
372-547 G3DSA:3.80.10.10

NFNNQLPKDVGLILASLRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYSLSWLKLSHNRFSGPIIRKSSDETSLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNLLTGTIPRWLGNFFLEVLRISNNRLQGAIPPSLFNIPYLWLLDLSGNFLSGSLP

HMMPfam: PF13855
387-447 LRR_8,Leucine rich repeat

SLRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYSLSWLKLSHNRF

ProfileScan: PS51450
IPR001611
387-409 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRHLNLSNNEFLGNMPSSMARM

superfamily: SSF52047
401-848 SSF52047,LRR

NMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYSLSWLKLSHNRFSGPIIRKSSDETSLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNLLTGTIPRWLGNFFLEVLRISNNRLQGAIPPSLFNIPYLWLLDLSGNFLSGSLPLRSSSDYGYILDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPLFRSTPSISVVLLRENNLTGKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGSGGHSNADSDWYPASLLSNFMEIYTEVYYESLIVSDRFSLDYSVDFNVQVEFAVKQRYDLYMRGTLNQMFGLDLSSNELSGNIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKLHGTIPSQLTLLQSLVVFNVSYNNLSGVIPQGKQFNTFGEKSYLGNFLLCGSPTKRSCGGTTISSGKEYEDDDE

ProfileScan: PS51450
IPR001611
436-456 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSWLKLSHNRFSGPIIRKSS

ProfileScan: PS51450
IPR001611
484-506 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLSVIDLSNNLLTGTIPRWLGNF

HMMPfam: PF00560
IPR001611
485-505 LRR_1
Leucine-rich repeat

LSVIDLSNNLLTGTIPRWLGN

ProfileScan: PS51450
IPR001611
507-529 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEVLRISNNRLQGAIPPSLFNI

HMMPfam: PF00560
IPR001611
508-527 LRR_1
Leucine-rich repeat

LEVLRISNNRLQGAIPPSLF

ProfileScan: PS51450
IPR001611
531-552 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLWLLDLSGNFLSGSLPLRSSS

Gene3D: G3DSA:3.80.10.10
558-649 G3DSA:3.80.10.10

LDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPLFRSTPSISVVLLRENNLTGKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGS

ProfileScan: PS51450
IPR001611
576-598 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRLLDLRNNKLSGNIPLFRSTP

HMMPfam: PF00560
IPR001611
577-594 LRR_1
Leucine-rich repeat

LRLLDLRNNKLSGNIPLF

ProfileScan: PS51450
IPR001611
623-645 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NVRMLDFAHNRLNESIPSCVTNL

ProfileScan: PS51450
IPR001611
716-739 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QMFGLDLSSNELSGNIPEELGDLK

HMMPfam: PF13855
720-775 LRR_8,Leucine rich repeat

LDLSSNELSGNIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKL

Gene3D: G3DSA:3.80.10.10
720-828 G3DSA:3.80.10.10

LDLSSNELSGNIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKLHGTIPSQLTLLQSLVVFNVSYNNLSGVIPQGKQFNTFGEKSYLGNFLLCGSPT

ProfileScan: PS51450
IPR001611
740-762 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RVRSLNLSRNSLSGSIPGSFSNL

FPrintScan: PR00019
762-775 LEURICHRPT,Leucine-rich repeat signature

LRSIESLDLSFNKL

ProfileScan: PS51450
IPR001611
764-786 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIESLDLSFNKLHGTIPSQLTLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox