PRGDB00050506 (T6H20.290)

From PRG Wiki
Jump to: navigation, search
T6H20.290
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5578750 (AL096859)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 3, BAC clone T6H20.

DNA Sequence

ATGGTAGATGCGATCACAGAGTTTGTTGTGGGAAAGATCGACAACTATCTCATCGAAGAAGCGCCAATGTTGATAGGAGTCAAAGACGATCTAGAGGAGCTGAAGACAGAGTTGACGTGCATCCAAGTTTATCTCAAAAATGTTGAAGTTTGTGACAAAGAAGATGAGGTCTCAAAAGAGTGGACAAAACTGGTTTTAGACATTGCTTATGACGTCGAAGATGTTTTGGACACCTATTTTCTGAAACTAGAAAAAAGACTACACAGACTAGGCTTGATGAGATTGACCAACATAATAAGCGATAAGAAGGATGCGTACAACATACTTGATGATATCAAAACCCTCAAAAGAAGAACTTTGGATGTTACTCGCAAACTTGAGATGTATGGGATAGGAAACTTTAATGAGCATCGAGTAGTAGCGAGTACTTCAAGGGTGAGGGAAGTTCGGCGTGCTCGATCTGATGATCAGGAAGAGCGTGTAGTTGGTTTGACAGATGATGCTAAGGTTCTTTTGACAAAGCTTCTTGATGATGATGGGGATAACAAGATATATATGATCTCCATATTCGGCATGGAAGGTCTCGGGAAGACTTCTCTTGCAAGAAAGCTTTTTAACTCTAGCGATGTGAAGGAAAGCTTTGAATATCGAGTATGGACTAATGTTTCTGGAGAATGTAATACAAGAGATATACTTATGAGAATCATAAGCTCTTTGGAAGAAACATCTGAGGGAGAGCTTGAAAAGATGGCTCAGCAGGAGTTAGAAGTTTACCTTCATGATATTCTACAAGAGAAAAGATATCTTGTGGTGGTAGATGATATATGGGAGAGTGAAGCATTGGAGAGCTTGAAGCGAGCGTTACCTTGCAGCTATCAAGGAAGTAGAGTCATCATCACTACAAGTATTAGAGTCGTGGCTGAAGGCAGGGACAAGAGAGTCTACACCCATAACATAAGGTTCTTAACGTTTAAAGAAAGCTGGAACTTGTTTGAGAAGAAAGCATTTAGATATATCTTAAAGGTCGATCAAGAACTGCAGAAAATCGGAAAAGAAATGGTTCAAAAATGTGGTGGATTACCGCGTACTACAGTGGTTCTTGCCGGGCTTATGTCCAGGAAGAAGCCAAACGAGTGGAACGATGTGTGGTCCAGTTTGCGTGTAAAGGATGACAACATTCATGTCTCCAGTTTGTTTGACCTAAGCTTCAAGGATATGGGACATGAGTTAAAGCTCTGCTTTCTTTACCTTAGCGTCTTCCCCGAGGACTATGAGGTCGACGTAGAGAAATTGATACAGTTACTTGTAGCAGAAGGGTTTATACAAGAGGATGAAGAGATGACGATGGAAGATGTGGCTAGATATTATATTGAAGATCTGGTGTACATAAGCTTAGTGGAAGTCGTGAAAAGAAAGAAAGGGAAACTGATGTCTTTTAGAATCCATGATCTTGTAAGAGAATTTACTATCAAGAAATCCAAAGAGCTCAACTTTGTAAATGTTTACGACGAGCAGCATTCTTCTACTACTAGCAGAAGGGAAGTGGTTCACCATCTTATGGACGACAACTACTTGTGCGACAGACGTGTGAACACACAAATGCGATCTTTCTTGTTCTTCGGTAAACGGAGGAACGACATTACATATGTTGAAACCATTACTTTGAAACTGAAGTTACTTCGAGTGCTTAATCTTGGAGGACTTCATTTTATTTGTCAAGGATATAGCCCTTGGAGTTTACCAGATGTGATCGGAGGTTTAGTCCACTTGAGGTACCTTGGGATCGCCGATACCGTTGTGAACAACTTACCAGATTTCATCTCCAACTTACGGTTTCTACAGACACTAGATGCATCAGGCAACTCCTTCGAGCGAATGACTGATCTAAGTAACCTCACATCACTAAGGCATCTCACTGGAAGATTCATCGGAGAATTGCTTATAGGCGACGCAGTGAATCTTCAGACCTTGAGGTCTATCTCCTCCTATAGCTGGAGCAAACTAAAACATGAGTTACTCATAAATCTTCGGGACTTGGAGATCTACGAGTTCCACATATTGAACGACCAAATAAAAGTTCCTTTGGACTTAGTTTCCTTATCGAAACTCAAAAATCTTCGTGTCTTGAAGATTGAAGTAGTGTCCTTCAGCTTATTTTCCGAAGAAACAGTTCGTTTCGAACTCCTTGTCAAGCTAACACTGCATTGCGACGTAAGAAGACTTCCCAGAGACATGGATTTGATCTTTCCCAGTCTTGAGTCCCTGACACTTGTAACAAATCTCCAAGAAGACCCAATGCCTACTCTGCAAAAACTACAACGTTTAGAAAATCTAGTCTTGTATTCTTGTGTCTACCCGGGAGCGAAAATGTTCATCAACGCACAAGGTTTTGGTCGGCTGAGGAAACTTAAAGTGATCATAAAAAGATTAGATGAGTTGGAGATTGAAGAAGAAGCCATGCCATGTTTGATGAAGCTAAATCTTGACAATAAAGATGGAGCTACAAAGCTAATGATTCCCGATCGAATGCGAGCGTTTGTTTGA


Protein sequences

Name Description Sequence
putative protein putative protein [Arabidopsis thaliana].

MVDAITEFVVGKIDNYLIEEAPMLIGVKDDLEELKTELTCIQVYLKNVEVCDKEDEVSKEWTKLVLDIAYDVEDVLDTYFLKLEKRLHRLGLMRLTNIISDKKDAYNILDDIKTLKRRTLDVTRKLEMYGIGNFNEHRVVASTSRVREVRRARSDDQEERVVGLTDDAKVLLTKLLDDDGDNKIYMISIFGMEGLGKTSLARKLFNSSDVKESFEYRVWTNVSGECNTRDILMRIISSLEETSEGELEKMAQQELEVYLHDILQEKRYLVVVDDIWESEALESLKRALPCSYQGSRVIITTSIRVVAEGRDKRVYTHNIRFLTFKESWNLFEKKAFRYILKVDQELQKIGKEMVQKCGGLPRTTVVLAGLMSRKKPNEWNDVWSSLRVKDDNIHVSSLFDLSFKDMGHELKLCFLYLSVFPEDYEVDVEKLIQLLVAEGFIQEDEEMTMEDVARYYIEDLVYISLVEVVKRKKGKLMSFRIHDLVREFTIKKSKELNFVNVYDEQHSSTTSRREVVHHLMDDNYLCDRRVNTQMRSFLFFGKRRNDITYVETITLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNLRFLQTLDASGNSFERMTDLSNLTSLRHLTGRFIGELLIGDAVNLQTLRSISSYSWSKLKHELLINLRDLEIYEFHILNDQIKVPLDLVSLSKLKNLRVLKIEVVSFSLFSEETVRFELLVKLTLHCDVRRLPRDMDLIFPSLESLTLVTNLQEDPMPTLQKLQRLENLVLYSCVYPGAKMFINAQGFGRLRKLKVIIKRLDELEIEEEAMPCLMKLNLDNKDGATKLMIPDRMRAFV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF14
12-847 PTHR11017:SF14

KIDNYLIEEAPMLIGVKDDLEELKTELTCIQVYLKNVEVCDKEDEVSKEWTKLVLDIAYDVEDVLDTYFLKLEKRLHRLGLMRLTNIISDKKDAYNILDDIKTLKRRTLDVTRKLEMYGIGNFNEHRVVASTSRVREVRRARSDDQEERVVGLTDDAKVLLTKLLDDDGDNKIYMISIFGMEGLGKTSLARKLFNSSDVKESFEYRVWTNVSGECNTRDILMRIISSLEETSEGELEKMAQQELEVYLHDILQEKRYLVVVDDIWESEALESLKRALPCSYQGSRVIITTSIRVVAEGRDKRVYTHNIRFLTFKESWNLFEKKAFRYILKVDQELQKIGKEMVQKCGGLPRTTVVLAGLMSRKKPNEWNDVWSSLRVKDDNIHVSSLFDLSFKDMGHELKLCFLYLSVFPEDYEVDVEKLIQLLVAEGFIQEDEEMTMEDVARYYIEDLVYISLVEVVKRKKGKLMSFRIHDLVREFTIKKSKELNFVNVYDEQHSSTTSRREVVHHLMDDNYLCDRRVNTQMRSFLFFGKRRNDITYVETITLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNLRFLQTLDASGNSFERMTDLSNLTSLRHLTGRFIGELLIGDAVNLQTLRSISSYSWSKLKHELLINLRDLEIYEFHILNDQIKVPLDLVSLSKLKNLRVLKIEVVSFSLFSEETVRFELLVKLTLHCDVRRLPRDMDLIFPSLESLTLVTNLQEDPMPTLQKLQRLENLVLYSCVYPGAKMFINAQGFGRLRKLKVIIKRLDELEIEEEAMPCLMKLNLDNKDGATKLMIPDRMRAFV

HMMPanther: PTHR11017
12-847 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KIDNYLIEEAPMLIGVKDDLEELKTELTCIQVYLKNVEVCDKEDEVSKEWTKLVLDIAYDVEDVLDTYFLKLEKRLHRLGLMRLTNIISDKKDAYNILDDIKTLKRRTLDVTRKLEMYGIGNFNEHRVVASTSRVREVRRARSDDQEERVVGLTDDAKVLLTKLLDDDGDNKIYMISIFGMEGLGKTSLARKLFNSSDVKESFEYRVWTNVSGECNTRDILMRIISSLEETSEGELEKMAQQELEVYLHDILQEKRYLVVVDDIWESEALESLKRALPCSYQGSRVIITTSIRVVAEGRDKRVYTHNIRFLTFKESWNLFEKKAFRYILKVDQELQKIGKEMVQKCGGLPRTTVVLAGLMSRKKPNEWNDVWSSLRVKDDNIHVSSLFDLSFKDMGHELKLCFLYLSVFPEDYEVDVEKLIQLLVAEGFIQEDEEMTMEDVARYYIEDLVYISLVEVVKRKKGKLMSFRIHDLVREFTIKKSKELNFVNVYDEQHSSTTSRREVVHHLMDDNYLCDRRVNTQMRSFLFFGKRRNDITYVETITLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNLRFLQTLDASGNSFERMTDLSNLTSLRHLTGRFIGELLIGDAVNLQTLRSISSYSWSKLKHELLINLRDLEIYEFHILNDQIKVPLDLVSLSKLKNLRVLKIEVVSFSLFSEETVRFELLVKLTLHCDVRRLPRDMDLIFPSLESLTLVTNLQEDPMPTLQKLQRLENLVLYSCVYPGAKMFINAQGFGRLRKLKVIIKRLDELEIEEEAMPCLMKLNLDNKDGATKLMIPDRMRAFV

superfamily: SSF52540
144-386 SSF52540

SRVREVRRARSDDQEERVVGLTDDAKVLLTKLLDDDGDNKIYMISIFGMEGLGKTSLARKLFNSSDVKESFEYRVWTNVSGECNTRDILMRIISSLEETSEGELEKMAQQELEVYLHDILQEKRYLVVVDDIWESEALESLKRALPCSYQGSRVIITTSIRVVAEGRDKRVYTHNIRFLTFKESWNLFEKKAFRYILKVDQELQKIGKEMVQKCGGLPRTTVVLAGLMSRKKPNEWNDVWSSL

HMMPfam: PF00931
IPR002182
170-444 NB-ARC,NBS
NB-ARC

VLLTKLLDDDGDNKIYMISIFGMEGLGKTSLARKLFNSSDVKESFEYRVWTNVSGECNTRDILMRIISSLEETSEGELEKMAQQELEVYLHDILQEKRYLVVVDDIWESEALESLKRALPCSYQGSRVIITTSIRVVAEGRDKRVYTHNIRFLTFKESWNLFEKKAFRYILKVDQELQKIGKEMVQKCGGLPRTTVVLAGLMSRKKPNEWNDVWSSLRVKDDNIHVSSLFDLSFKDMGHELKLCFLYLSVFPEDYEVDVEKLIQLLVAEGFIQED

FPrintScan: PR00364
IPR000767
186-201 DISEASERSIST
Disease resistance protein

MISIFGMEGLGKTSLA

Gene3D: G3DSA:3.40.50.300
186-305 G3DSA:3.40.50.300

MISIFGMEGLGKTSLARKLFNSSDVKESFEYRVWTNVSGECNTRDILMRIISSLEETSEGELEKMAQQELEVYLHDILQEKRYLVVVDDIWESEALESLKRALPCSYQGSRVIITTSIRV

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

ILQEKRYLVVVDDIW

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CGGLPRTTVVLAGLM

superfamily: SSF52058
480-830 SSF52058,LRR

RIHDLVREFTIKKSKELNFVNVYDEQHSSTTSRREVVHHLMDDNYLCDRRVNTQMRSFLFFGKRRNDITYVETITLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNLRFLQTLDASGNSFERMTDLSNLTSLRHLTGRFIGELLIGDAVNLQTLRSISSYSWSKLKHELLINLRDLEIYEFHILNDQIKVPLDLVSLSKLKNLRVLKIEVVSFSLFSEETVRFELLVKLTLHCDVRRLPRDMDLIFPSLESLTLVTNLQEDPMPTLQKLQRLENLVLYSCVYPGAKMFINAQGFGRLRKLKVIIKRLDELEIEEEAMPCLMKLNLDN

Gene3D: G3DSA:3.80.10.10
544-831 G3DSA:3.80.10.10

RNDITYVETITLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNLRFLQTLDASGNSFERMTDLSNLTSLRHLTGRFIGELLIGDAVNLQTLRSISSYSWSKLKHELLINLRDLEIYEFHILNDQIKVPLDLVSLSKLKNLRVLKIEVVSFSLFSEETVRFELLVKLTLHCDVRRLPRDMDLIFPSLESLTLVTNLQEDPMPTLQKLQRLENLVLYSCVYPGAKMFINAQGFGRLRKLKVIIKRLDELEIEEEAMPCLMKLNLDNK

FPrintScan: PR00364
IPR000767
608-624 DISEASERSIST
Disease resistance protein

SNLRFLQTLDASGNSFE

ProfileScan: PS51450
IPR001611
612-633 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLQTLDASGNSFERMTDLSNLT

ProfileScan: PS51450
IPR001611
751-773 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLESLTLVTNLQEDPMPTLQKLQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox