PRGDB00050507 (T6H20.290)

From PRG Wiki
Jump to: navigation, search
T6H20.290
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5578750 (AL096859)
Gene Class CN
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 3, BAC clone T6H20.

DNA Sequence

ATGGTAGATGCTGTCACTGGTTTCGTTTTGAATAAGATCGGCGGCTATCTCATCAATGAAGTATTGGCGTTGATGGGAGTCAAAGATGATCTAGAGGAGCTGAAGACGGAGTTGACGTGCATCCATGGTTATCTTAAGGATGTTGAAGCTCGAGAAAGAGAAGATGAGGTCTCGAAAGAGTGGACAAAACTGGTTTTAGATATCGCCTATGATATCGAGGATGTTTTGGACACCTATTTCTTGAAACTTGAAGAAAGATCACTAAGACGAGGCTTGTTGAGATTGACCAACAAAATAGGCAAAAAGAGAGATGCTTACAACATAGTTGAAGATATTAGAACCCTGAAGAGAAGAATCTTGGATATAACTCGCAAGCGGGAGACTTTTGGTATAGGAAGCTTCAATGAGCCTCGAGGAGAGAATATTACAAATGTTAGAGTGAGGCAGCTTCGACGTGCTCCACCTGTTGATCAAGAAGAGCTAGTGGTTGGTTTGGAAGATGATGTTAAGATTCTTTTGGTAAAGCTTCTTAGTGATAATGAGAAAGACAAGAGTTATATTATCTCCATATTCGGTATGGGAGGTCTAGGAAAAACTGCACTTGCCAGGAAGCTTTACAACTCGGGGGATGTGAAGAGAAGATTTGATTGCCGTGCGTGGACCTATGTTTCTCAAGAGTATAAAACAAGAGATATACTTATCAGAATTATAAGATCGCTGGGAATAGTTTCTGCAGAAGAAATGGAAAAGATCAAAATGTTTGAAGAGGATGAGGAGTTAGAAGTTTACCTTTACGGTCTTCTAGAGGGAAAAAATTATATGGTGGTAGTAGACGATGTATGGGATCCAGACGCGTGGGAGAGCTTGAAGAGAGCATTACCATGCGATCACAGAGGAAGTAAAGTCATCATCACAACGCGTATTAGAGCAATAGCTGAAGGTGTGGAGGGGACAGTCTACGCTCATAAGTTAAGGTTCTTGACGTTTGAAGAAAGCTGGACGTTGTTTGAACGGAAAGCATTCAGCAATATTGAAAAGGTTGATGAGGATCTGCAGAGAACTGGAAAAGAAATGGTTAAAAAATGCGGTGGATTACCGCTTGCTATAGTCGTGCTTTCTGGGCTTTTGTCTAGGAAAAGGACAAACGAGTGGCATGAGGTGTGTGCTAGTTTATGGCGACGCCTAAAGGATAACTCCATTCACATTTCCACTGTGTTTGATCTAAGCTTTAAGGAGATGCGACATGAGTTGAAACTTTGCTTTCTTTACTTTAGCGTCTTCCCTGAGGACTACGAGATCAAGGTAGAGAAATTGATACACTTACTTGTAGCAGAAGGGTTTATACAAGAAGATGAAGAGATGATGATGGAAGACGTGGCTCGATGTTATATTGACGAGCTGGTAGATAGAAGTTTAGTGAAAGCTGAAAGAATTGAAAGAGGAAAGGTGATGTCTTGTAGAATCCATGATCTACTGAGAGACTTGGCTATCAAGAAAGCTAAAGAGCTTAACTTTGTAAATGTTTACAACGAGAAGCAGCATTCTTCTGATATTTGCAGAAGAGAAGTGGTTCACCATCTTATGAACGACTATTACTTGTGTGACAGACGTGTAAACAAACGAATGCGATCCTTCTTATTCATCGGAGAACGGAGGGGTTTTGGTTATGTCAATACCACAAACTTGAAACTGAAGCTACTTCGAGTGCTAAATATGGAAGGGCTTTTGTTTGTTAGTAAAAATATCAGCAATACTTTACCAGATGTGATCGGGGAATTAATCCATTTGAGGTATCTAGGGATTGCTGATACTTACGTTAGCATTTTACCAGCTTCCATCTCCAATTTACGGTTTCTACAAACACTAGATGCGTCAGGCAATGATCCCTTCCAGTACACAACCGATCTTAGTAAGCTCACATCACTAAGGCATGTCATCGGAAAATTTGTGGGAGAATGTCTAATAGGCGAAGGAGTAAACCTTCAGACCTTGAGGTCTATCTCTTCCTACAGCTGGAGCAAACTGAACCATGAGTTACTCAGAAATCTTCAGGACTTGGAGATCTACGATCACTCTAAGTGGGTAGACCAGAGAAGAGTTCCTTTAAACTTTGTTTCTTTCTCTAAACCGAAAAATCTCCGTGTCCTAAAGCTTGAAATGAGAAACTTCAAGTTATCATCGGAATCAAGGACAACAATTGGGTTAGTGGATGTGAACTTTCCCAGTCTTGAGTCTCTGACACTTGTCGGAACAACTCTTGAGGAAAACTCAATGCCTGCTTTGCAGAAGTTACCTAGACTGGAAGATCTGGTCTTGAAAGATTGTAATTACTCGGGAGTGAAGATCATGAGCATCAGTGCACAAGGTTTTGGTCGGTTGAAGAATCTTGAAATGTCCATGGAAAGAAGAGGCCATGGATTAGATGAGTTGCGAATTGAAGAAGAGGCCATGCCTAGTTTAATAAAGCTGACTGTGAAGGGCCGATTAGAACTAACTAAGCTGATGATTCCTGATCGATTGAAAGCGTTTGTTCGACGCAACTAA


Protein sequences

Name Description Sequence
putative protein putative protein [Arabidopsis thaliana].

MVDAVTGFVLNKIGGYLINEVLALMGVKDDLEELKTELTCIHGYLKDVEAREREDEVSKEWTKLVLDIAYDIEDVLDTYFLKLEERSLRRGLLRLTNKIGKKRDAYNIVEDIRTLKRRILDITRKRETFGIGSFNEPRGENITNVRVRQLRRAPPVDQEELVVGLEDDVKILLVKLLSDNEKDKSYIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTRDILIRIIRSLGIVSAEEMEKIKMFEEDEELEVYLYGLLEGKNYMVVVDDVWDPDAWESLKRALPCDHRGSKVIITTRIRAIAEGVEGTVYAHKLRFLTFEESWTLFERKAFSNIEKVDEDLQRTGKEMVKKCGGLPLAIVVLSGLLSRKRTNEWHEVCASLWRRLKDNSIHISTVFDLSFKEMRHELKLCFLYFSVFPEDYEIKVEKLIHLLVAEGFIQEDEEMMMEDVARCYIDELVDRSLVKAERIERGKVMSCRIHDLLRDLAIKKAKELNFVNVYNEKQHSSDICRREVVHHLMNDYYLCDRRVNKRMRSFLFIGERRGFGYVNTTNLKLKLLRVLNMEGLLFVSKNISNTLPDVIGELIHLRYLGIADTYVSILPASISNLRFLQTLDASGNDPFQYTTDLSKLTSLRHVIGKFVGECLIGEGVNLQTLRSISSYSWSKLNHELLRNLQDLEIYDHSKWVDQRRVPLNFVSFSKPKNLRVLKLEMRNFKLSSESRTTIGLVDVNFPSLESLTLVGTTLEENSMPALQKLPRLEDLVLKDCNYSGVKIMSISAQGFGRLKNLEMSMERRGHGLDELRIEEEAMPSLIKLTVKGRLELTKLMIPDRLKAFVRRN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-836 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MVDAVTGFVLNKIGGYLINEVLALMGVKDDLEELKTELTCIHGYLKDVEAREREDEVSKEWTKLVLDIAYDIEDVLDTYFLKLEERSLRRGLLRLTNKIGKKRDAYNIVEDIRTLKRRILDITRKRETFGIGSFNEPRGENITNVRVRQLRRAPPVDQEELVVGLEDDVKILLVKLLSDNEKDKSYIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTRDILIRIIRSLGIVSAEEMEKIKMFEEDEELEVYLYGLLEGKNYMVVVDDVWDPDAWESLKRALPCDHRGSKVIITTRIRAIAEGVEGTVYAHKLRFLTFEESWTLFERKAFSNIEKVDEDLQRTGKEMVKKCGGLPLAIVVLSGLLSRKRTNEWHEVCASLWRRLKDNSIHISTVFDLSFKEMRHELKLCFLYFSVFPEDYEIKVEKLIHLLVAEGFIQEDEEMMMEDVARCYIDELVDRSLVKAERIERGKVMSCRIHDLLRDLAIKKAKELNFVNVYNEKQHSSDICRREVVHHLMNDYYLCDRRVNKRMRSFLFIGERRGFGYVNTTNLKLKLLRVLNMEGLLFVSKNISNTLPDVIGELIHLRYLGIADTYVSILPASISNLRFLQTLDASGNDPFQYTTDLSKLTSLRHVIGKFVGECLIGEGVNLQTLRSISSYSWSKLNHELLRNLQDLEIYDHSKWVDQRRVPLNFVSFSKPKNLRVLKLEMRNFKLSSESRTTIGLVDVNFPSLESLTLVGTTLEENSMPALQKLPRLEDLVLKDCNYSGVKIMSISAQGFGRLKNLEMSMERRGHGLDELRIEEEAMPSLIKLTVKGRLELTKLMI

HMMPanther: PTHR23155:SF243
1-836 PTHR23155:SF243,DISEASE RESISTANCE PROTEIN (CC-NBS CLASS)

MVDAVTGFVLNKIGGYLINEVLALMGVKDDLEELKTELTCIHGYLKDVEAREREDEVSKEWTKLVLDIAYDIEDVLDTYFLKLEERSLRRGLLRLTNKIGKKRDAYNIVEDIRTLKRRILDITRKRETFGIGSFNEPRGENITNVRVRQLRRAPPVDQEELVVGLEDDVKILLVKLLSDNEKDKSYIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTRDILIRIIRSLGIVSAEEMEKIKMFEEDEELEVYLYGLLEGKNYMVVVDDVWDPDAWESLKRALPCDHRGSKVIITTRIRAIAEGVEGTVYAHKLRFLTFEESWTLFERKAFSNIEKVDEDLQRTGKEMVKKCGGLPLAIVVLSGLLSRKRTNEWHEVCASLWRRLKDNSIHISTVFDLSFKEMRHELKLCFLYFSVFPEDYEIKVEKLIHLLVAEGFIQEDEEMMMEDVARCYIDELVDRSLVKAERIERGKVMSCRIHDLLRDLAIKKAKELNFVNVYNEKQHSSDICRREVVHHLMNDYYLCDRRVNKRMRSFLFIGERRGFGYVNTTNLKLKLLRVLNMEGLLFVSKNISNTLPDVIGELIHLRYLGIADTYVSILPASISNLRFLQTLDASGNDPFQYTTDLSKLTSLRHVIGKFVGECLIGEGVNLQTLRSISSYSWSKLNHELLRNLQDLEIYDHSKWVDQRRVPLNFVSFSKPKNLRVLKLEMRNFKLSSESRTTIGLVDVNFPSLESLTLVGTTLEENSMPALQKLPRLEDLVLKDCNYSGVKIMSISAQGFGRLKNLEMSMERRGHGLDELRIEEEAMPSLIKLTVKGRLELTKLMI

superfamily: SSF52540
145-398 SSF52540

VRVRQLRRAPPVDQEELVVGLEDDVKILLVKLLSDNEKDKSYIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTRDILIRIIRSLGIVSAEEMEKIKMFEEDEELEVYLYGLLEGKNYMVVVDDVWDPDAWESLKRALPCDHRGSKVIITTRIRAIAEGVEGTVYAHKLRFLTFEESWTLFERKAFSNIEKVDEDLQRTGKEMVKKCGGLPLAIVVLSGLLSRKRTNEWHEVCASLWRRLKDN

HMMPfam: PF00931
IPR002182
166-451 NB-ARC,NBS
NB-ARC

EDDVKILLVKLLSDNEKDKSYIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTRDILIRIIRSLGIVSAEEMEKIKMFEEDEELEVYLYGLLEGKNYMVVVDDVWDPDAWESLKRALPCDHRGSKVIITTRIRAIAEGVEGTVYAHKLRFLTFEESWTLFERKAFSNIEKVDEDLQRTGKEMVKKCGGLPLAIVVLSGLLSRKRTNEWHEVCASLWRRLKDNSIHISTVFDLSFKEMRHELKLCFLYFSVFPEDYEIKVEKLIHLLVAEGFIQED

Gene3D: G3DSA:3.40.50.300
177-308 G3DSA:3.40.50.300

LSDNEKDKSYIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTRDILIRIIRSLGIVSAEEMEKIKMFEEDEELEVYLYGLLEGKNYMVVVDDVWDPDAWESLKRALPCDHRGSKVIITTRI

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

IISIFGMGGLGKTALA

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

LLEGKNYMVVVDDVW

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CGGLPLAIVVLSGLL

superfamily: SSF52047
564-798 SSF52047,LRR

LKLLRVLNMEGLLFVSKNISNTLPDVIGELIHLRYLGIADTYVSILPASISNLRFLQTLDASGNDPFQYTTDLSKLTSLRHVIGKFVGECLIGEGVNLQTLRSISSYSWSKLNHELLRNLQDLEIYDHSKWVDQRRVPLNFVSFSKPKNLRVLKLEMRNFKLSSESRTTIGLVDVNFPSLESLTLVGTTLEENSMPALQKLPRLEDLVLKDCNYSGVKIMSISAQGFGRLKNLEM

Gene3D: G3DSA:3.80.10.10
565-799 G3DSA:3.80.10.10

KLLRVLNMEGLLFVSKNISNTLPDVIGELIHLRYLGIADTYVSILPASISNLRFLQTLDASGNDPFQYTTDLSKLTSLRHVIGKFVGECLIGEGVNLQTLRSISSYSWSKLNHELLRNLQDLEIYDHSKWVDQRRVPLNFVSFSKPKNLRVLKLEMRNFKLSSESRTTIGLVDVNFPSLESLTLVGTTLEENSMPALQKLPRLEDLVLKDCNYSGVKIMSISAQGFGRLKNLEMS

FPrintScan: PR00364
IPR000767
614-630 DISEASERSIST
Disease resistance protein

SNLRFLQTLDASGNDPF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox