PRGDB00050508 (AT4g27190)

From PRG Wiki
Jump to: navigation, search
AT4g27190
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4490701 (AL035680)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, BAC clone T24A18, partial sequence (ESSA project).

DNA Sequence

ATGGAGTGTTGCGCCCCTGTCATTGGTGAGATTTTGCGTTTGATGTATGAGTCAACGTTCTCAAGAGTCGCTAATGCCATAAAGTTCAAATCAAACGTCAAAGCTCTTAATGAATCACTCGAGAGATTGACAGAGCTTAAGGGTAACATGAGTGAAGATCATGAAACTTTGCTGACCAAAGATAAACCCTTGAGACTCAAGCTAATGCGTTGGCAAAGAGAGGCGGAAGAAGTTATATCTAAAGCAAGGTTAAAACTTGAGGAACGAGTTTCATGCGGTATGTCCTTGAGACCCAGGATGAGTAGGAAACTTGTCAAGATTCTCGATGAAGTGAAAATGCTTGAGAAGGATGGAATAGAGTTTGTCGACATGCTTTCCGTGGAGTCTACACCGGAAAGAGTTGAACATGTTCCAGGGGTCTCAGTTGTTCATCAAACGATGGCGTCAAATATGTTGGCCAAAATTAGAGATGGCTTGACAAGCGAGAAAGCCCAAAAGATTGGTGTTTGGGGCATGGGAGGAGTAGGTAAAACGACATTGGTCAGGACGCTGAACAATAAGCTTCGGGAAGAGGGTGCTACTCAACCATTTGGCTTGGTGATCTTTGTAATAGTTTCCAAAGAGTTTGATCCAAGAGAAGTCCAAAAGCAGATTGCGGAGAGACTGGATATTGATACCCAAATGGAAGAAAGTGAAGAGAAGTTGGCAAGAAGGATTTATGTTGGACTGATGAAAGAGAGAAAGTTTCTTCTCATTCTTGATGACGTTTGGAAACCCATTGATTTGGATCTTTTAGGCATCCCACGAACTGAAGAGAACAAAGGTTCAAAAGTCATTCTGACTTCGAGGTTTTTAGAGGTCTGTCGCAGCATGAAGACAGATCTTGATGTTAGAGTGGATTGCTTACTTGAAGAAGACGCTTGGGAATTGTTTTGCAAAAATGCAGGGGATGTTGTGAGGTCAGACCATGTTAGGAAGATTGCAAAAGCTGTTTCACAAGAATGTGGTGGATTGCCTCTTGCTATCATCACAGTCGGAACAGCTATGCGGGGAAAGAAAAATGTCAAGCTATGGAATCATGTCTTGAGTAAGCTAAGTAAATCAGTACCTTGGATCAAGAGCATTGAAGAGAAGATCTTCCAGCCATTGAAATTGAGCTACGATTTCTTGGAAGACAAGGCAAAGTTTTGTTTTCTCCTTTGTGCTTTGTTTCCAGAAGACTACTCGATTGAAGTTACAGAGGTTGTAAGATATTGGATGGCTGAAGGATTCATGGAGGAACTCGGTTCCCAAGAGGACTCCATGAACGAGGGAATCACAACTGTGGAGAGTTTAAAGGATTATTGTTTGTTAGAAGATGGTGATCGTAGAGACACGGTGAAGATGCATGATGTTGTCCGCGATTTCGCCATATGGATCATGTCTTCCTCACAAGATGATTCCCATTCCCTTGTCATGTCTGGAACGGGTTTGCAAGATATTAGACAAGATAAGCTTGCTCCTTCTCTTCGAAGGGTTTCTTTGATGAACAATAAACTAGAAAGCCTTCCTGATCTTGTAGAAGAGTTCTGCGTAAAAACCTCAGTCTTACTGCTACAAGGCAATTTTCTTCTAAAGGAAGTACCCATTGGATTCTTGCAAGCATTTCCAACTCTTCGAATCTTGAATCTAAGTGGGACTCGCATTAAGTCATTTCCCAGTTGCTCTCTTTTGCGCCTTTTCAGTCTCCATTCTCTCTTCTTAAGAGATTGTTTTAAACTTGTGAAACTACCTTCACTAGAAACCCTTGCCAAACTTGAGCTACTTGATCTCTGTGGCACACATATCCTCGAATTTCCAAGAGGGTTGGAAGAATTAAAGAGATTCAGACACCTTGATCTTTCACGAACACTTCACCTTGAAAGCATTCCAGCTAGAGTTGTTTCGAGGTTATCAAGTTTGGAGACACTTGACATGACGTCAAGTCACTACCGCTGGAGCGTACAGGGAGAAACACAAAAAGGGCAAGCAACAGTTGAAGAGATAGGATGCCTCCAGCGTTTACAGGTTCTTTCCATCAGGCTCCATTCTTCTCCATTTCTTTTAAATAAGAGAAACACTTGGATCAAAAGATTGAAGAAATTCCAACTTGTAGTTGGGTCTCGTTACATTTTGCGTACAAGGCACGACAAGAGGAGGCTAACAATAAGTCACCTCAACGTATCACAAGTATCCATCGGGTGGCTGTTGGCTTATACAACATCTCTAGCACTAAACCATTGTCAGGGGATCGAAGCAATGATGAAGAAATTGGTAAGTGACAACAAGGGTTTCAAGAATTTGAAATCTCTGACGATTGAGAACGTTATCATCAATACGAATTCTTGGGTTGAGATGGTAAGCACTAACACTTCAAAACAATCCTCTGACATACTAGACCTTCTTCCAAATTTGGAGGAACTTCATCTGCGTCGTGTTGACTTGGAAACCTTCTCAGAGCTACAAACACATCTCGGGTTGAAACTGGAAACACTGAAGATAATCGAGATCACCATGTGTCGCAAGCTTCGAACACTACTCGACAAAAGAAATTTCTTGACTATCCCAAACCTGGAGGAGATAGAGATTAGCTACTGCGACTCTTTGCAGAATCTACACGAGGCTTTGTTATACCATCAACCTTTCGTACCAAATCTACGTGTCTTGAAACTGAGAAATCTTCCAAATCTTGTGAGTATATGCAACTGGGGAGAGGTTTGGGAATGCTTGGAACAAGTGGAAGTGATTCACTGTAATCAGCTGAATTGTTTACCCATAAGCTCTACCTGTGGAAGAATCAAGAAGATAAAAGGAGAATTGAGTTGGTGGGAGCGTTTGGAATGGGACGATCCCTCTGCTTTAACCACTGTTCAACCATTTTTCAATCCAGTGAGGGAAGTTCCTCTACTCATAGCGGATGCAACAACTCAAATGCTATAA


Protein sequences

Name Description Sequence
putative protein putative protein [Arabidopsis thaliana].

MECCAPVIGEILRLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLMRWQREAEEVISKARLKLEERVSCGMSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLPISSTCGRIKKIKGELSWWERLEWDDPSALTTVQPFFNPVREVPLLIADATTQML

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
13-985 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLMRWQREAEEVISKARLKLEERVSCGMSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLPISSTCGRIKKIKGELSWWERLEWDDPSALTTVQPFFNPVREVPLLIADATTQML

HMMPanther: PTHR23155:SF108
13-985 PTHR23155:SF108,SUBFAMILY NOT NAMED

RLMYESTFSRVANAIKFKSNVKALNESLERLTELKGNMSEDHETLLTKDKPLRLKLMRWQREAEEVISKARLKLEERVSCGMSLRPRMSRKLVKILDEVKMLEKDGIEFVDMLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFMEELGSQEDSMNEGITTVESLKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLPISSTCGRIKKIKGELSWWERLEWDDPSALTTVQPFFNPVREVPLLIADATTQML

superfamily: SSF52540
124-371 SSF52540

MLSVESTPERVEHVPGVSVVHQTMASNMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPW

HMMPfam: PF00931
IPR002182
150-426 NB-ARC,NBS
NB-ARC

NMLAKIRDGLTSEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEEDAWELFCKNAGDVVRSDHVRKIAKAVSQECGGLPLAIITVGTAMRGKKNVKLWNHVLSKLSKSVPWIKSIEEKIFQPLKLSYDFLEDKAKFCFLLCALFPEDYSIEVTEVVRYWMAEGFME

Gene3D: G3DSA:3.40.50.300
161-266 G3DSA:3.40.50.300

SEKAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLG

HMMSmart: SM00382
IPR003593
163-305 AAA,NBS
AAA+ ATPase domain

KAQKIGVWGMGGVGKTTLVRTLNNKLREEGATQPFGLVIFVIVSKEFDPREVQKQIAERLDIDTQMEESEEKLARRIYVGLMKERKFLLILDDVWKPIDLDLLGIPRTEENKGSKVILTSRFLEVCRSMKTDLDVRVDCLLEE

FPrintScan: PR00364
IPR000767
166-181 DISEASERSIST
Disease resistance protein

KIGVWGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
243-257 DISEASERSIST
Disease resistance protein

LMKERKFLLILDDVW

FPrintScan: PR00364
IPR000767
335-349 DISEASERSIST
Disease resistance protein

CGGLPLAIITVGTAM

superfamily: SSF52058
445-920 SSF52058,LRR

LKDYCLLEDGDRRDTVKMHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYRWSVQGETQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKRNTWIKRLKKFQLVVGSRYILRTRHDKRRLTISHLNVSQVSIGWLLAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVE

Gene3D: G3DSA:3.80.10.10
501-658 G3DSA:3.80.10.10

PSLRRVSLMNNKLESLPDLVEEFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPARVVSRLSSLETLDMTSSHYR

ProfileScan: PS51450
IPR001611
502-523 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRRVSLMNNKLESLPDLVEEF

ProfileScan: PS51450
IPR001611
551-572 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRILNLSGTRIKSFPSCSLLR

HMMPfam: PF00560
IPR001611
552-569 LRR_1
Leucine-rich repeat

LRILNLSGTRIKSFPSCS

ProfileScan: PS51450
IPR001611
575-597 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLHSLFLRDCFKLVKLPSLETLA

FPrintScan: PR00364
IPR000767
594-610 DISEASERSIST
Disease resistance protein

ETLAKLELLDLCGTHIL

ProfileScan: PS51450
IPR001611
598-620 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLELLDLCGTHILEFPRGLEELK

Gene3D: G3DSA:3.80.10.10
747-931 G3DSA:3.80.10.10

TSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSSDILDLLPNLEELHLRRVDLETFSELQTHLGLKLETLKIIEITMCRKLRTLLDKRNFLTIPNLEEIEISYCDSLQNLHEALLYHQPFVPNLRVLKLRNLPNLVSICNWGEVWECLEQVEVIHCNQLNCLP

ProfileScan: PS51450
IPR001611
810-831 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEELHLRRVDLETFSELQTHL

ProfileScan: PS51450
IPR001611
848-868 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRTLLDKRNFLTIPNLEEIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox