PRGDB00050510 (AT4g27400)

From PRG Wiki
Jump to: navigation, search
AT4g27400
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3269280 (AL030978)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, P1 clone M4I22 (ESSA project).

DNA Sequence

ATGTTCAGATCGAACGCAAGAGCGTTGAATAGAGCATTGGAGAGACTAAAGAATGTGCAGACCAAGGTGAATGAAGCTCTTAAGAGATCAGGGATCCAAGAGAAATCTTTGGAGCGAAAGCTGAGGATATGGCTAAGAAAGGTCGAAGAGAATGTGCCTCTTGGTGAGCTGATTTTGGAGAAACGCTCTTCATGTGCTATATGGCTGAGCGACAAAGATGTGGAAATTCTTGAGAAAGTCAAAAGGCTGGAGGAGCAAGGCCAAGATCTCATAAAAAAGATTTCAGTCAACAAGTCATCTAGAGAAATAGTTGAACGGGTCTTGGGGCCTTCATTTCATCCTCAAAAAACAGCACTGGAGATGTTGGATAAGCTAAAGGATTGTTTGAAGAAGAAGAATGTTCAAAAGATTGGTGTTTGGGGTATGGGCGGTGTTGGGAAGACAACACTTGTCAGGACGCTTAACAATGATCTCTTGAAATATGCTGCTACTCAACAGTTTGCTTTGGTAATTTGGGTGACAGTGTCGAAAGATTTTGACTTAAAAAGGGTCCAGATGGACATAGCCAAGAGACTGGGCAAGCGATTTACAAGGGAGCAAATGAATCAGCTAGGCTTAACTATTTGTGAGAGGCTAATAGATTTGAAAAATTTCCTCCTTATTCTTGACGATGTTTGGCACCCCATTGATTTGGACCAATTGGGTATTCCATTAGCATTGGAACGATCGAAGGATTCAAAGGTTGTTCTAACTTCAAGAAGACTAGAAGTGTGCCAACAGATGATGACTAATGAAAACATCAAAGTTGCATGCTTACAAGAGAAAGAAGCTTGGGAATTGTTTTGCCACAACGTTGGAGAAGTAGCAAACTCTGATAATGTTAAGCCCATTGCAAAGGATGTATCCCATGAATGTTGTGGATTGCCTTTGGCTATCATCACAATCGGGCGGACCCTGCGCGGAAAACCTCAAGTCGAGGTATGGAAACACACCTTGAATTTGCTAAAGAGATCAGCACCTTCTATCGATACTGAAGAAAAGATCTTTGGTACTTTAAAACTCAGCTACGACTTTCTTCAAGACAATATGAAAAGTTGCTTCCTTTTCTGTGCTTTATTTCCGGAGGACTACTCTATCAAAGTAAGTGAACTAATAATGTACTGGGTCGCGGAAGGATTGTTGGATGGACAACATCATTACGAGGACATGATGAATGAGGGAGTTACTTTGGTTGAGAGATTGAAGGACTCTTGCCTGTTAGAAGATGGTGATAGTTGTGATACAGTTAAAATGCACGATGTTGTGCGTGACTTTGCTATATGGTTCATGTCTTCTCAGGGTGAAGGATTTCATTCTCTTGTCATGGCCGGGAGAGGTCTAATAGAGTTTCCACAAGATAAGTTTGTTTCTTCAGTCCAGAGAGTTTCTTTGATGGCTAATAAGCTAGAAAGACTACCTAATAATGTGATAGAGGGTGTGGAAACATTAGTTTTACTACTACAAGGGAATTCCCATGTTAAGGAAGTTCCTAATGGGTTCTTACAAGCATTCCCAAACCTTAGAATCTTGGATCTCAGTGGTGTTCGTATAAGAACATTGCCAGACTCCTTTTCAAATCTTCATAGTTTGCGGTCTCTTGTGTTAAGAAACTGTAAAAAATTGAGGAACCTGCCTTCGCTAGAATCCCTTGTTAAACTCCAATTTCTTGATCTACATGAATCTGCCATTAGGGAACTTCCGAGAGGTCTTGAAGCGTTGAGCAGCTTAAGATACATTTGCGTTTCCAACACATATCAACTCCAGAGCATTCCGGCTGGAACTATTCTCCAGTTATCAAGTTTGGAGGTTCTAGACATGGCGGGGAGTGCTTATAGTTGGGGCATCAAGGGAGAAGAAAGAGAAGGACAAGCAACACTTGACGAGGTTACATGCCTCCCTCATTTGCAGTTTCTTGCCATTAAGCTCCTCGATGTCTTGTCCTTTTCCTATGAATTTGATTCTTTGACCAAAAGGCTAACAAAGTTCCAGTTTCTATTTTCACCTATTCGATCGGTTTCACCTCCTGGCACCGGTGAAGGTTGCCTAGCAATCAGTGATGTCAATGTCTCAAATGCATCTATTGGGTGGCTACTGCAACATGTGACATCACTAGACTTGAACTATTGTGAGGGTCTTAATGGTATGTTCGAGAACTTGGTAACGAAGAGCAAAAGTAGCTTTGTTGCCATGAAAGCACTGTCCATTCACTATTTTCCCAGCTTAAGCCTTGCGAGTGGTTGTGAGTCCCAACTGGATCTCTTTCCAAATCTCGAGGAACTTTCTTTGGACAATGTCAATCTGGAAAGCATCGGAGAACTTAATGGTTTCCTCGGGATGAGACTTCAGAAACTAAAACTACTTCAAGTCTCTGGCTGCCGACAGCTTAAACGTCTTTTCTCAGACCAAATCTTAGCAGGTACTCTGCCAAACCTACAAGAGATAAAGGTTGTCTCATGTTTGAGGTTGGAGGAGCTCTTCAATTTTTCTTCAGTGCCAGTTGATTTTTGTGCTGAGTCTTTGCTACCTAAGCTAACTGTCATAAAACTCAAATATCTTCCACAATTAAGGAGCTTATGCAACGACAGAGTGGTGCTCGAATCCCTGGAACACTTAGAAGTCGAATCTTGTGAAAGTTTAAAGAACTTACCCTTTGTCCCCGGCAATACTGGTATGATCAACGAACAAATGGCGTGGGAATACATGTCTAGGACTCTAGGGTAA


Protein sequences

Name Description Sequence
putative protein putative protein [Arabidopsis thaliana].

MFRSNARALNRALERLKNVQTKVNEALKRSGIQEKSLERKLRIWLRKVEENVPLGELILEKRSSCAIWLSDKDVEILEKVKRLEEQGQDLIKKISVNKSSREIVERVLGPSFHPQKTALEMLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCESLKNLPFVPGNTGMINEQMAWEYMSRTLG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
4-901 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SNARALNRALERLKNVQTKVNEALKRSGIQEKSLERKLRIWLRKVEENVPLGELILEKRSSCAIWLSDKDVEILEKVKRLEEQGQDLIKKISVNKSSREIVERVLGPSFHPQKTALEMLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCESLKNLPFVPGN

HMMPfam: PF00931
IPR002182
121-395 NB-ARC,NBS
NB-ARC

MLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFGTLKLSYDFLQDNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLD

superfamily: SSF52540
122-341 SSF52540

LDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPS

Gene3D: G3DSA:3.40.50.300
124-259 G3DSA:3.40.50.300

KLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQ

FPrintScan: PR00364
IPR000767
136-151 DISEASERSIST
Disease resistance protein

KIGVWGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
212-226 DISEASERSIST
Disease resistance protein

LIDLKNFLLILDDVW

FPrintScan: PR00364
IPR000767
305-319 DISEASERSIST
Disease resistance protein

CCGLPLAIITIGRTL

superfamily: SSF52058
430-890 SSF52058,LRR

KMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCE

Gene3D: G3DSA:3.80.10.10
468-716 G3DSA:3.80.10.10

FVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTS

HMMPfam: PF13855
498-552 LRR_8,Leucine rich repeat

LLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCK

Gene3D: G3DSA:3.80.10.10
717-896 G3DSA:3.80.10.10

LDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSLASGCESQLDLFPNLEELSLDNVNLESIGELNGFLGMRLQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLESLEHLEVESCESLKNLP

FPrintScan: PR00364
IPR000767
792-808 DISEASERSIST
Disease resistance protein

MRLQKLKLLQVSGCRQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox