PRGDB00050512 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 26522777 (AB086391)
Gene Class NL
Domain Type NBS, LRR
Gene Species Glycine max

Comment?

Glycine max mRNA for hypothetical protein, partial cds.

DNA Sequence

GAGCAGATCTTATTTACCAAGTGAAGCCATTGGATGACACCGATGCTCTTCGATTGTTTTGCAAAAATGCATTTAAAAATAATTATATTATGAGTGATTTTAAAACGTTGACTTCTCATGTACTATCACATTGTGAAGGTCATCCCTTAGCAATTGAAGTATTGGGCTCATCTTTGTTTGGTAAAGATGTCTCTTATTG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Glycine max].

ADLIYQVKPLDDTDALRLFCKNAFKNNYIMSDFKTLTSHVLSHCEGHPLAIEVLGSSLFGKDVSY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
3-62 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LIYQVKPLDDTDALRLFCKNAFKNNYIMSDFKTLTSHVLSHCEGHPLAIEVLGSSLFGKD

HMMPanther: PTHR11017:SF20
3-62 PTHR11017:SF20,SUBFAMILY NOT NAMED

LIYQVKPLDDTDALRLFCKNAFKNNYIMSDFKTLTSHVLSHCEGHPLAIEVLGSSLFGKD

HMMPfam: PF00931
IPR002182
5-62 NB-ARC,NBS
NB-ARC

YQVKPLDDTDALRLFCKNAFKNNYIMSDFKTLTSHVLSHCEGHPLAIEVLGSSLFGKD


List of References

Tsuneo Hakoyama, Tadashi Yokoyama, Hiroshi Kouchi, Ken-ichi Tsuchiya, Hisatoshi Kaku, Yasuhiro Arima
Transcriptional response of soybean suspension-cultured cells induced by Nod factors obtained from Bradyrhizobium japonicum USDA110.
Plant Cell Physiol.: 2002, 43(11);1314-22
PubMed:12461131 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox