PRGDB00050517 (unnamed protein product [Arabidopsis thaliana].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Arabidopsis thaliana].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2828187 (AB010693)
Gene Class TNL
Domain Type TIR, LRR, NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K21C13.

DNA Sequence

ATGGGCGCCTCCTTCTCCCTCTTTACCGACGTTGGACCGATCCCGCCTCAGTATCAAGTGTTCATCAACTTCCGAGGCGAAAAACTTCGTGATGGGTTCCTAGGGTTTCTTGTGGATGCTCTTTTAAAAGAGAATGTCAACGTTTTTATAGATGATCATGAGCTTAGAGGCAGAGATCTTGATCATCTCTTCAGTAGGATCGAGGAATCGAGAGTCGCATTGACAATCTTCTCCAAGAACTTCACCAACTCAAGATGGTGCTTAGATGAGCTTGCTAAGATCAAAGAATGTGTGGATCAAGAAAGTCTTACAGTGATTCCTATCTTCTTTAAGATGAAAACAGACGATGTGAAGAAACTGAAGGGGAATTTTGGAGACAACTTCCGGGACCTGAAGTTAACGCATCGCGGCGAGCCTGAAACTTATCGGAGATGGAAAGATGCTATACTGTATGTTTCTAAGAAAACTGGCTTGTCTTCGTCACGATACAGGTCTGGACTTTGTCCCTTTGCTTATGTTCTTTGTTGGAAACTTGGAATACTCTGTTTCTTGACTCTGTTCTTGAATGATTTGGTCAACACAATCGTCGAGGAGGTTAAGAAAGTTCTAAACGATATCGCCGAGATCGAACGACAAATTGCTGAAGAGAAGCGCAACCATTTGGCGGCAAGAACAGATGAATTGATTAGACTTGTTGTCCGGTTCCTAAGTCTGTTTCTTCTTTTTACAATAGTTTTTGGTCCTTATGTTTTAGGCCTTCTCACTTTTTTCTCTTTTCTTGTGGGTCGTTTGATAATCAATCGAGCTGTGGAAAGTGAGTGGTGA


Protein sequences

Name Description Sequence
unnamed protein product [Arabidopsis thaliana]. unnamed protein product [Arabidopsis thaliana].

MGASFSLFTDVGPIPPQYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGLSSSRYRSGLCPFAYVLCWKLGILCFLTLFLNDLVNTIVEEVKKVLNDIAEIERQIAEEKRNHLAARTDELIRLVVRFLSLFLLFTIVFGPYVLGLLTFFSFLVGRLIINRAVESEW

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
6-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SLFTDVGPIPPQYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGL

ProfileScan: PS50104
IPR000157
16-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

PQYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKK

HMMSmart: SM00255
IPR000157
17-155 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKK

Gene3D: G3DSA:3.40.50.10140
17-141 G3DSA:3.40.50.10140

QYQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPET

HMMPfam: PF01582
IPR000157
20-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDA

HMMPanther: PTHR23155:SF66
27-159 PTHR23155:SF66,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

EKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGLS

HMMPanther: PTHR23155
27-159 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EKLRDGFLGFLVDALLKENVNVFIDDHELRGRDLDHLFSRIEESRVALTIFSKNFTNSRWCLDELAKIKECVDQESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLTHRGEPETYRRWKDAILYVSKKTGLS


List of References

T Kaneko, H Kotani, Y Nakamura, S Sato, E Asamizu, N Miyajima, S Tabata
Structural analysis of Arabidopsis thaliana chromosome 5. V. Sequence features of the regions of 1,381,565 bp covered by twenty one physically assigned P1 and TAC clones.
DNA Res.: 1998, 5(2);131-45
PubMed:9679202 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox