PRGDB00050561 (Dm3-like protein)

From PRG Wiki
Jump to: navigation, search
Dm3-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32364410 (AY206053)
Gene Class N
Domain Type NBS, Others
Gene Species Lactuca sativa

Comment?

Lactuca sativa cultivar BIB Dm3-like protein gene, partial cds.

DNA Sequence

ATGTCGGACCCAACGGGGATTGCTGGTGCCATTATTAACCCAATTGCTCAGACGGCCTTGGTTCCCGTTACGGACCATGTAGGCTACATGATTTCCTGCAGAAAATATGTGAGGGTTATGCAGACGAAAATGAGAGAGTTGAATACCTCAAGAATCAGTGTAGAGGAACACATTAGCCGGAACACAAGAAATCATCTTCAGATTCCATCTCAAACTAAGGAATGGTTGGACCAAGTAGAAGGGCTCAGAGCAAATGTGGCAAACTTTCCAATTGATGTCATCAGTTGTTGTAGTCTCAGGATCAGGCACAAGCTTGGACAGAAAGCCTTCAAGATAACTGAGCAGATTGAAAGTCTAACGAGACAACTCTCCCTGATCAGTTGGACTGATGATCCAGTTCCTCTAGGAAGAGTTGGTTCCATGAATGCATCCACCTCTGCATCATCAAGTGATGATTTCCCATCAAGAGAGAAAACTTTTACACAAGCACTAAAAGCACTCGAACCCAACCAAAAATTCCACATGGTAGCCTTGTGTGGGATGGGTGGAGTGGGGAAGACTAGAATGATGCAAAGGCTGAAGAAGGCTGCTGAAGAAAAGAAATTGTTTAATTATATTGTTGGGGCAGTTATAGGGGAAAAGACGGACCCCTTTGCCATTCAAGAAGCTATAGCAGATTACCTCGGTATACAACTCAATGAAAAAACTAAGCCAGCAAGAGCTGATAAGCTTCGTGAATGGTTCAAAAAGAATTCAGATGGAGGTAAGACTAAGTTCCTCATAGTACTTGACGATGTTTGGCAATTAGTTGATCTTGAAGATATTGGGTTAAGTCCTTTTCCAAATCAAGGTGTCGACTTCAAGGTCTTGTTGACATCACGAGACTCACAAGTTTGCACTATGATGGGGGTTGAAGCTAATTCAATTATTAACGTGGGCCTTCTAACTGAAGCAGAAGCTCAAAGTCTGTTCCAGCAATTTGTAGAAACTTCTGAGCCCGAGCTCCAGAAGATAGGAGAGGATATCGTAAGGAAGTGTTGCGGTCTACCTATTGCCATAAAAACCATGGCATGTACTCTTAGAAATAAAAGAAAGGATGCATGGAAGGATGCACTTTCGCGCATAGAG


Protein sequences

Name Description Sequence
Dm3-like protein Dm3-like protein [Lactuca sativa].

MSDPTGIAGAIINPIAQTALVPVTDHVGYMISCRKYVRVMQTKMRELNTSRISVEEHISRNTRNHLQIPSQTKEWLDQVEGLRANVANFPIDVISCCSLRIRHKLGQKAFKITEQIESLTRQLSLISWTDDPVPLGRVGSMNASTSASSSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRIE

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
127-375 SSF52540

SWTDDPVPLGRVGSMNASTSASSSDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSRI

Gene3D: G3DSA:3.40.50.300
150-274 G3DSA:3.40.50.300

SDDFPSREKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLED

HMMPfam: PF00931
IPR002182
157-374 NB-ARC,NBS
NB-ARC

EKTFTQALKALEPNQKFHMVALCGMGGVGKTRMMQRLKKAAEEKKLFNYIVGAVIGEKTDPFAIQEAIADYLGIQLNEKTKPARADKLREWFKKNSDGGKTKFLIVLDDVWQLVDLEDIGLSPFPNQGVDFKVLLTSRDSQVCTMMGVEANSIINVGLLTEAEAQSLFQQFVETSEPELQKIGEDIVRKCCGLPIAIKTMACTLRNKRKDAWKDALSR

FPrintScan: PR00364
IPR000767
175-190 DISEASERSIST
Disease resistance protein

MVALCGMGGVGKTRMM

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

DGGKTKFLIVLDDVW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CCGLPIAIKTMACTL


List of References

Hanhui Kuang, Oswaldo E Ochoa, Eviatar Nevo, Richard W Michelmore
The disease resistance gene Dm3 is infrequent in natural populations of Lactuca serriola due to deletions and frequent gene conversions at the RGC2 locus.
Plant J.: 2006, 47(1);38-48
PubMed:16762035 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox