PRGDB00050581 (RGC2 resistance protein 4A)

From PRG Wiki
Jump to: navigation, search
RGC2 resistance protein 4A
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32364362 (AY206023)
Gene Class Unknown
Domain Type
Gene Species Lactuca sativa

Comment?

Lactuca sativa cultivar Lednicky RGC2 resistance protein 4A gene, partial cds.

DNA Sequence

CTTACATTGGATAATTATGAAGGAGTGGAGGTGGTATTTGAGATAGAGAGTGAGAGTCCAACATGTAGAGAATTGGTAACAACTCGCAATAACCAACAACAGCCTATTATACTTCCCTACCTCCAGGATTTGTATCTAAGGAATATGGACAACACGAGTCATGTGTGGAAGTGCAGCAACTGGAATAAATTCTTCACTCTTCCAAAACAACAATCAGAATCCCCATTCCACAACCTCACAACCATAAATATTCTTAAATGCAAAAGCATTAAGTACTTGTTTTCGCCTCTCATGGCAGAACTTCTTTCCAACCTAAAGGATATCCGGATAAGTGAGTGTGATGGTATTAAAGAAGTTGTTTCAAACAGAGATGATGAGGATGAAGAAATGACTACATTTACATCTACCCACACAACCACCACTTTGTTCCCTAGTCTTGATTCTCTCACTCTAAGTTTCCTGGAGAATCTGAAGTGTATTGGTGGAGGTGGTGCCAAGGATGAGGGGAGCAATGAAATATCTTTCAATAATACCACTGCAAC


Protein sequences

Name Description Sequence
RGC2 resistance protein 4A RGC2 resistance protein 4A [Lactuca sativa].

LTLDNYEGVEVVFEIESESPTCRELVTTRNNQQQPIILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPLMAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENLKCIGGGGAKDEGSNEISFNNTTAT

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
37-157 G3DSA:3.80.10.10

ILPYLQDLYLRNMDNTSHVWKCSNWNKFFTLPKQQSESPFHNLTTINILKCKSIKYLFSPLMAELLSNLKDIRISECDGIKEVVSNRDDEDEEMTTFTSTHTTTTLFPSLDSLTLSFLENL


List of References

Hanhui Kuang, Oswaldo E Ochoa, Eviatar Nevo, Richard W Michelmore
The disease resistance gene Dm3 is infrequent in natural populations of Lactuca serriola due to deletions and frequent gene conversions at the RGC2 locus.
Plant J.: 2006, 47(1);38-48
PubMed:16762035 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox