PRGDB00050602 (9E)

From PRG Wiki
Jump to: navigation, search
9E
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 50512299 (AY569331)
Gene Class Unknown
Domain Type
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium 9DC resistance gene cluster.

DNA Sequence

GATCCCGTGATTAATGCAGCGTTCGAGGTGTTTTCGGGGAAATTGAAAGAGCTTGAAGGGATTATTGATGGTAGAAATAATGATAGCAAGTTGAATAATAGAAATGGAGCTGGTGTTATGCCTTATGAATTGTTGAAACCTTATTCTGAACCTGGAGTTACTGGAAAAGGTGTACCTTATAGCATTTCCATTTGA


Protein sequences

Name Description Sequence
LoxC-like LoxC-like [Lycopersicon pimpinellifolium].

DPVINAAFEVFSGKLKELEGIIDGRNNDSKLNNRNGAGVMPYELLKPYSEPGVTGKGVPYSISI

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.20.245.10
1-64 G3DSA:1.20.245.10

DPVINAAFEVFSGKLKELEGIIDGRNNDSKLNNRNGAGVMPYELLKPYSEPGVTGKGVPYSISI

HMMPanther: PTHR11771:SF2
1-64 PTHR11771:SF2,LIPOXYGENASE

DPVINAAFEVFSGKLKELEGIIDGRNNDSKLNNRNGAGVMPYELLKPYSEPGVTGKGVPYSISI

HMMPanther: PTHR11771
IPR000907
1-64 LipOase
Lipoxygenase

DPVINAAFEVFSGKLKELEGIIDGRNNDSKLNNRNGAGVMPYELLKPYSEPGVTGKGVPYSISI

ProfileScan: PS51393
IPR013819
1-64 LIPOXYGENASE_3
Lipoxygenase, C-terminal

DPVINAAFEVFSGKLKELEGIIDGRNNDSKLNNRNGAGVMPYELLKPYSEPGVTGKGVPYSISI

HMMPfam: PF00305
IPR013819
1-47 Lipoxygenase
Lipoxygenase, C-terminal

DPVINAAFEVFSGKLKELEGIIDGRNNDSKLNNRNGAGVMPYELLKP

superfamily: SSF48484
IPR013819
1-64 Lipoxygenase
Lipoxygenase, C-terminal

DPVINAAFEVFSGKLKELEGIIDGRNNDSKLNNRNGAGVMPYELLKPYSEPGVTGKGVPYSISI


List of References

Marco Kruijt, Bas F Brandwagt, Pierre J G M de Wit
Rearrangements in the Cf-9 disease resistance gene cluster of wild tomato have resulted in three genes that mediate Avr9 responsiveness.
Genetics: 2004, 168(3);1655-63
PubMed:15579714 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox