PRGDB00050605 (9E)

From PRG Wiki
Jump to: navigation, search
9E
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 50512299 (AY569331)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium 9DC resistance gene cluster.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACCTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTACAATTCAAGAACATGTTTACCGTTAATCCTAATGCTTTTCATTATTGTCCTGACATAACAGGCCGAGAGATTCAGTCATATCCGAGAACTCTTTCTTGGAACAAGAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGCGCTTGACCTCCGTTGCAGCCAACTTCAAGGCAAGTTTCATTCAAACAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGGCTTGATCTGTCGAATAATAACTTCATTGGATCGCTCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGGATTCTAGTTTTACGGGTGTAATCCCTTCTGAAATCTCTCATCTTTCTAAACTACACGTTCTTCTTATCGGTGATCAATATGGGCTTAGTATTGTACCTCACAATTTTGAACCGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCAACCTTTACGAAGTGAACCTCTCTTCCACAGTTCCATCAAATTTCTCTTCTCATTTAACAACTCTACAACTTTCAGGCACAGGGTTACGTGGGTTATTGCCCGAAAGAGTTTTCCACCTTTCCGACTTAGAATTTCTCGATTTATCATATAATTCCCAGCTCATGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGAAGTTATACGTCCATAGTGTGAATATTGCTGATAGGATACCTGAATCATTTAGCCATCTAACTTCACTTCATGAGTTGGACATGGGTTATACTAATCTATCAGGGCCTATTCCTAAACCTTTATGGAATCTCACCAACATAGAGAGTTTGGACCTTCGTTATAACCATCTTGAAGGACCAATTCCCCAGCTCCCGATATTTGAAAAGCTCAAGAAGTTATCACTTTTTAGAAATGACAATTTGGATGGCGGACTTGAGTTCTTATCCTTTAACACCCAACTTGAACGGCTAGATTTATCATCCAATTCCCTAACTGGTCCAATTCCATCCAACATAAGCGGACTTCAAAACCTAGAATGTCTCTACTTGTCATCAAACCACTTGAATGGGAGTATACCTTCCTGGATATTCTCCCTTCCTTCACTGGTTGAGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTGCCGTTACTCTAAAACAAAATAAGCTGAAAGGTCGTATTCCGAATTCACTCCTAAACCAGAAGAACCTACAATTACTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTGATATTGTTAGACTTGGGAAGTAATAATTTGGAGGGAACAATCCCACAATGCGTGGTTGAGAGGAACGAATACCTTTCGCATTTGGATTTGAGCAAAAACAGACTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAACATTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTATGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATTTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTATGGGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGGAAATTGATGAGAGTACAGGATTCCCAGAGTATATTTCTGATCCATATGATATTTATTACAATTATTTGACGACAATTTCTACAAAGGGACAAGATTATGATTCTGTTCGAATTTTGGATTCTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTGTCTCACAATGTCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGGTGAAGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAAAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
9DC2 9DC2 [Lycopersicon pimpinellifolium].

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLLIGDQYGLSIVPHNFEPLLKNLTQLRELNLYEVNLSSTVPSNFSSHLTTLQLSGTGLRGLLPERVFHLSDLEFLDLSYNSQLMVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLDLRYNHLEGPIPQLPIFEKLKKLSLFRNDNLDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGGEDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTKMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-786 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLLIGDQYGLSIVPHNFEPLLKNLTQLRELNLYEVNLSSTVPSNFSSHLTTLQLSGTGLRGLLPERVFHLSDLEFLDLSYNSQLMVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLDLRYNHLEGPIPQLPIFEKLKKLSLFRNDNLDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPanther: PTHR24420
1-786 PTHR24420,FAMILY NOT NAMED

MGCVKLVFFMLYVFLFQLVSSSSLPHLCPEDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLLIGDQYGLSIVPHNFEPLLKNLTQLRELNLYEVNLSSTVPSNFSSHLTTLQLSGTGLRGLLPERVFHLSDLEFLDLSYNSQLMVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLDLRYNHLEGPIPQLPIFEKLKKLSLFRNDNLDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCG

HMMPfam: PF08263
IPR013210
30-85 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCD

Gene3D: G3DSA:3.80.10.10
70-347 G3DSA:3.80.10.10

WNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLLIGDQYGLSIVPHNFEPLLKNLTQLRELNLYEVNLSSTVPSNFSSHLTTLQLSGTGLRGLLPERVFHLSDLEFLDLSYNSQLMVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLDLRYNHLEGPIPQLPIFEKLKKLSLFRNDN

superfamily: SSF52047
93-420 SSF52047,LRR

ALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSNNNFIGSLISPKFGEFSDLTHLDLSDSSFTGVIPSEISHLSKLHVLLIGDQYGLSIVPHNFEPLLKNLTQLRELNLYEVNLSSTVPSNFSSHLTTLQLSGTGLRGLLPERVFHLSDLEFLDLSYNSQLMVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLDLRYNHLEGPIPQLPIFEKLKKLSLFRNDNLDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFS

HMMPfam: PF13516
114-130 LRR_6,Leucine Rich repeat

LSNLKRLDLSNNNFIGS

HMMPfam: PF00560
IPR001611
142-163 LRR_1
Leucine-rich repeat

LTHLDLSDSSFTGVIPSEISHL

HMMPfam: PF13855
265-324 LRR_8,Leucine rich repeat

SLMKLYVHSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLDLRYNHL

Gene3D: G3DSA:3.80.10.10
355-512 G3DSA:3.80.10.10

LSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKN

HMMPfam: PF13855
360-417 LRR_8,Leucine rich repeat

QLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNN

superfamily: SSF52058
429-774 SSF52058,LRR

KTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMPfam: PF13855
503-562 LRR_8,Leucine rich repeat

YLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNML

FPrintScan: PR00019
504-517 LEURICHRPT,Leucine-rich repeat signature

LSHLDLSKNRLSGT

Gene3D: G3DSA:3.80.10.10
513-629 G3DSA:3.80.10.10

RLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKE

HMMPfam: PF00560
IPR001611
602-624 LRR_1
Leucine-rich repeat

LQILDLSSNGFSGNLPERILGNL

Gene3D: G3DSA:3.80.10.10
673-783 G3DSA:3.80.10.10

INLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSK

HMMPfam: PF13855
693-752 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

FPrintScan: PR00019
739-752 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox