PRGDB00050616 (disease resistance-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 71363561 (DQ104376)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Populus tremula

Comment?

Populus tremula clone P1-RGA11 disease resistance-like protein gene, partial cds.

DNA Sequence

ATGCCAGGAGTGGGTAAGACTACTATAGCAAAAGTTGTATTTAATCAACTCTGCTATGACTGTGGATATGGATTCGAGGGAATCTCTTTTCTTTTGAATGTCAAAGAAAAGTCAGAACCTAATGATTTGGTTCTTCTACAACAACAACTACTTCATGATATCTTAAGACAAAATACTGAGAAGATCCATAGTGTTGATAGAGGAAAGGTTCTGATTAAAGAACGACTCTGGCGCAAAAGAGTTCTTGTTGTTGTTGATGATGTGGATCATCTGCAACAATTAAATGCTTTGATGGGAGAGCGAAGCTGGTTTGGTCCCGGAAGCAGGGTGATAATTACAACTAGAGATGAACGCTTACTTCTTGAAGCTGATCAAAGATACCAGGTTCAAGAATTGGACCCATATGAGTCCCTTCAGCTATTCTGTCAGCATGCGTTTAGGGACGCCAAGCCAGCAAAAGATTATGTTGAGCTTTCTAATGATGTAGTTGAATACTGTGGAGGCCTCCCGCTCGCTCTTGAG


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Populus tremula].

MPGVGKTTIAKVVFNQLCYDCGYGFEGISFLLNVKEKSEPNDLVLLQQQLLHDILRQNTEKIHSVDRGKVLIKERLWRKRVLVVVDDVDHLQQLNALMGERSWFGPGSRVIITTRDERLLLEADQRYQVQELDPYESLQLFCQHAFRDAKPAKDYVELSNDVVEYCGGLPLALE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-173 PTHR11017:SF20,SUBFAMILY NOT NAMED

MPGVGKTTIAKVVFNQLCYDCGYGFEGISFLLNVKEKSEPNDLVLLQQQLLHDILRQNTEKIHSVDRGKVLIKERLWRKRVLVVVDDVDHLQQLNALMGERSWFGPGSRVIITTRDERLLLEADQRYQVQELDPYESLQLFCQHAFRDAKPAKDYVELSNDVVEYCGGLPLAL

HMMPanther: PTHR11017
1-173 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MPGVGKTTIAKVVFNQLCYDCGYGFEGISFLLNVKEKSEPNDLVLLQQQLLHDILRQNTEKIHSVDRGKVLIKERLWRKRVLVVVDDVDHLQQLNALMGERSWFGPGSRVIITTRDERLLLEADQRYQVQELDPYESLQLFCQHAFRDAKPAKDYVELSNDVVEYCGGLPLAL

HMMPfam: PF00931
IPR002182
1-173 NB-ARC,NBS
NB-ARC

MPGVGKTTIAKVVFNQLCYDCGYGFEGISFLLNVKEKSEPNDLVLLQQQLLHDILRQNTEKIHSVDRGKVLIKERLWRKRVLVVVDDVDHLQQLNALMGERSWFGPGSRVIITTRDERLLLEADQRYQVQELDPYESLQLFCQHAFRDAKPAKDYVELSNDVVEYCGGLPLAL

superfamily: SSF52540
1-173 SSF52540

MPGVGKTTIAKVVFNQLCYDCGYGFEGISFLLNVKEKSEPNDLVLLQQQLLHDILRQNTEKIHSVDRGKVLIKERLWRKRVLVVVDDVDHLQQLNALMGERSWFGPGSRVIITTRDERLLLEADQRYQVQELDPYESLQLFCQHAFRDAKPAKDYVELSNDVVEYCGGLPLAL

Gene3D: G3DSA:3.40.50.300
2-123 G3DSA:3.40.50.300

PGVGKTTIAKVVFNQLCYDCGYGFEGISFLLNVKEKSEPNDLVLLQQQLLHDILRQNTEKIHSVDRGKVLIKERLWRKRVLVVVDDVDHLQQLNALMGERSWFGPGSRVIITTRDERLLLEA

FPrintScan: PR00364
IPR000767
75-89 DISEASERSIST
Disease resistance protein

RLWRKRVLVVVDDVD

FPrintScan: PR00364
IPR000767
166-174 DISEASERSIST
Disease resistance protein

CGGLPLALE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox