PRGDB00050622 (disease resistance-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 71363546 (DQ104367)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Populus tremula

Comment?

Populus tremula clone P1-RGA2 disease resistance-like protein gene, partial cds.

DNA Sequence

ATGCCAGGAGTCGGTAAGACTACTATAGCAGAAGTTGTATTTAATCAACTCTGCAATGGATTCGAGGGAAGCTGTTTTCTTTCGGATATAAATGAAAGATCAAAACAATTTAATGGTGGTCTTGTTGATTTACAAAAGCAACTTCTTCATGATATTTTAAATCAATATGTTGCAAACTTCGATTGTGCTGATAGAGGAAAGGTTCTGATCAAAGAACGACTTCGTCGCAAAAGAGTTCTTGTTGTTGCTGATGATGTTGCTCATCAGGACCAACTAAAAGCTTTGATGGGAGAGCGAAGTTGGTTTGGTCCCGGAAGTATAGTAATTTTTACAACGAGAGATTCAAATCTTCTTCGTGAAGCAGATCAAACATATCGGATCAAAGAATTGACACGAGATCAGTCCCTTCGGCTTTTCAGCTGGCATGCCTTTAAGGACACCAAGCCAGGAGAAGATTATATTGAGCTTTCAAAGAAAGCAGTTGATTACTGTGGAGGCTTGCCACTCGCTCTTGAG


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Populus tremula].

MPGVGKTTIAEVVFNQLCNGFEGSCFLSDINERSKQFNGGLVDLQKQLLHDILNQYVANFDCADRGKVLIKERLRRKRVLVVADDVAHQDQLKALMGERSWFGPGSIVIFTTRDSNLLREADQTYRIKELTRDQSLRLFSWHAFKDTKPGEDYIELSKKAVDYCGGLPLALE

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-171 SSF52540

MPGVGKTTIAEVVFNQLCNGFEGSCFLSDINERSKQFNGGLVDLQKQLLHDILNQYVANFDCADRGKVLIKERLRRKRVLVVADDVAHQDQLKALMGERSWFGPGSIVIFTTRDSNLLREADQTYRIKELTRDQSLRLFSWHAFKDTKPGEDYIELSKKAVDYCGGLPLAL

HMMPanther: PTHR11017:SF20
1-171 PTHR11017:SF20,SUBFAMILY NOT NAMED

MPGVGKTTIAEVVFNQLCNGFEGSCFLSDINERSKQFNGGLVDLQKQLLHDILNQYVANFDCADRGKVLIKERLRRKRVLVVADDVAHQDQLKALMGERSWFGPGSIVIFTTRDSNLLREADQTYRIKELTRDQSLRLFSWHAFKDTKPGEDYIELSKKAVDYCGGLPLAL

HMMPfam: PF00931
IPR002182
1-171 NB-ARC,NBS
NB-ARC

MPGVGKTTIAEVVFNQLCNGFEGSCFLSDINERSKQFNGGLVDLQKQLLHDILNQYVANFDCADRGKVLIKERLRRKRVLVVADDVAHQDQLKALMGERSWFGPGSIVIFTTRDSNLLREADQTYRIKELTRDQSLRLFSWHAFKDTKPGEDYIELSKKAVDYCGGLPLAL

HMMPanther: PTHR11017
1-171 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MPGVGKTTIAEVVFNQLCNGFEGSCFLSDINERSKQFNGGLVDLQKQLLHDILNQYVANFDCADRGKVLIKERLRRKRVLVVADDVAHQDQLKALMGERSWFGPGSIVIFTTRDSNLLREADQTYRIKELTRDQSLRLFSWHAFKDTKPGEDYIELSKKAVDYCGGLPLAL

Gene3D: G3DSA:3.40.50.300
2-122 G3DSA:3.40.50.300

PGVGKTTIAEVVFNQLCNGFEGSCFLSDINERSKQFNGGLVDLQKQLLHDILNQYVANFDCADRGKVLIKERLRRKRVLVVADDVAHQDQLKALMGERSWFGPGSIVIFTTRDSNLLREAD

FPrintScan: PR00364
IPR000767
73-87 DISEASERSIST
Disease resistance protein

RLRRKRVLVVADDVA

FPrintScan: PR00364
IPR000767
164-172 DISEASERSIST
Disease resistance protein

CGGLPLALE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox