PRGDB00050624 (At5g40090)

From PRG Wiki
Jump to: navigation, search
At5g40090
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 66792681 (BT023452)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At5g40090 gene, complete cds.

DNA Sequence

ATGACCTCTACGACGAAACCTTGCTCCGTTGGCTTCCTAGAAGAGCTCTTAGTGATACTCGAGTTTCAGGAAAAAGGTTCACTCATGGTCATACCCATTTTTCTTACAGATTTATCTTTTAATGTGGAAGAAATATGCAGACAACATCCGGAGAAGGCGCCAAGTTGGAGAACTGCACTTACCAAATTGACCAACCTTGCCGCTGAGTATCCATTATCTCAAAATCTTGCAGGAATGGATCAGTCAGATCTACTCAACCAAATTGCTCGTGACATATCTCTTGTCGTGTTCTACTCCGGATCAAACGATTCGAATGCCCTTGTTGCAATGGATCGTCACATGAAAGTGGTTTATGACTTGTTGGCTTTAGAAGTTAACAAAGAGGTTCGTACAATTGGCATTTGGGGTAGTGCTGGTGTTGGGAAGACAACACTTGCAAGGTACATTTATGCAGAGATCTTTGTAAACTTTCAGACACATGTTTTCCTAGATAATGTTGAAAACATGAAAGACAAGCTTCTAAAGTTTGAAGGAGAAGAAGATCCAACGGTAATAATAAGCTCATATCACGATGGACATGAAATTACCGAAGCAAGGCGTAAACACCGGAAAATTCTCCTTATCGCTGATGATGTGAACAACATGGAACAAGGGAAGTGGATCATTGAATATGCTAACTGGTTTGCTCCAGGAAGCAGAGTCATTCTTATTAGCCAGAACAAGAATTTGCTTGTTGACGCCGGAGTGATGGATGTGTACGAAGTCAGATCTTTAAGATATGATGAAGCTCTTCAAGTCTTCTCTCATTTTGCTTTCAAGCAGCCTTATCCACCTTCTGATTTCGAAGAGCTCGCAGTTCGTGCTGTCCATCTCGCAGGCTTTCTTCCTTTGGGCCTTAGACTGTTAGGGTCGTTTTTAGCTGGTAAAGGTCGAGAGGAGTGGGTAGCTGCACTGCTCAAACTCAAGGCAAAGCAAGGTGGACATATAATGGAAGTGTGGAAACTTATGGAAGCAACAGACGATAAAGGCCTAGAGGAGTGGGAAACTGCAGCCGATATAGTGGAAAGGAAGGAATCATCACAAGATAAAAGTCAACAAGAGAGTGAAGTTGCTGCAGACATTTTGATAGGAAAGGAATCATCACAAGATAAACAATAA


Protein sequences

Name Description Sequence
At5g40090 At5g40090 [Arabidopsis thaliana].

MTSTTKPCSVGFLEELLVILEFQEKGSLMVIPIFLTDLSFNVEEICRQHPEKAPSWRTALTKLTNLAAEYPLSQNLAGMDQSDLLNQIARDISLVVFYSGSNDSNALVAMDRHMKVVYDLLALEVNKEVRTIGIWGSAGVGKTTLARYIYAEIFVNFQTHVFLDNVENMKDKLLKFEGEEDPTVIISSYHDGHEITEARRKHRKILLIADDVNNMEQGKWIIEYANWFAPGSRVILISQNKNLLVDAGVMDVYEVRSLRYDEALQVFSHFAFKQPYPPSDFEELAVRAVHLAGFLPLGLRLLGSFLAGKGREEWVAALLKLKAKQGGHIMEVWKLMEATDDKGLEEWETAADIVERKESSQDKSQQESEVAADILIGKESSQDKQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
12-332 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLEELLVILEFQEKGSLMVIPIFLTDLSFNVEEICRQHPEKAPSWRTALTKLTNLAAEYPLSQNLAGMDQSDLLNQIARDISLVVFYSGSNDSNALVAMDRHMKVVYDLLALEVNKEVRTIGIWGSAGVGKTTLARYIYAEIFVNFQTHVFLDNVENMKDKLLKFEGEEDPTVIISSYHDGHEITEARRKHRKILLIADDVNNMEQGKWIIEYANWFAPGSRVILISQNKNLLVDAGVMDVYEVRSLRYDEALQVFSHFAFKQPYPPSDFEELAVRAVHLAGFLPLGLRLLGSFLAGKGREEWVAALLKLKAKQGGHIMEV

HMMPanther: PTHR11017:SF20
12-332 PTHR11017:SF20,SUBFAMILY NOT NAMED

FLEELLVILEFQEKGSLMVIPIFLTDLSFNVEEICRQHPEKAPSWRTALTKLTNLAAEYPLSQNLAGMDQSDLLNQIARDISLVVFYSGSNDSNALVAMDRHMKVVYDLLALEVNKEVRTIGIWGSAGVGKTTLARYIYAEIFVNFQTHVFLDNVENMKDKLLKFEGEEDPTVIISSYHDGHEITEARRKHRKILLIADDVNNMEQGKWIIEYANWFAPGSRVILISQNKNLLVDAGVMDVYEVRSLRYDEALQVFSHFAFKQPYPPSDFEELAVRAVHLAGFLPLGLRLLGSFLAGKGREEWVAALLKLKAKQGGHIMEV

superfamily: SSF52540
107-329 SSF52540

LVAMDRHMKVVYDLLALEVNKEVRTIGIWGSAGVGKTTLARYIYAEIFVNFQTHVFLDNVENMKDKLLKFEGEEDPTVIISSYHDGHEITEARRKHRKILLIADDVNNMEQGKWIIEYANWFAPGSRVILISQNKNLLVDAGVMDVYEVRSLRYDEALQVFSHFAFKQPYPPSDFEELAVRAVHLAGFLPLGLRLLGSFLAGKGREEWVAALLKLKAKQGGHI

HMMPfam: PF00931
IPR002182
113-326 NB-ARC,NBS
NB-ARC

HMKVVYDLLALEVNKEVRTIGIWGSAGVGKTTLARYIYAEIFVNFQTHVFLDNVENMKDKLLKFEGEEDPTVIISSYHDGHEITEARRKHRKILLIADDVNNMEQGKWIIEYANWFAPGSRVILISQNKNLLVDAGVMDVYEVRSLRYDEALQVFSHFAFKQPYPPSDFEELAVRAVHLAGFLPLGLRLLGSFLAGKGREEWVAALLKLKAKQG

Gene3D: G3DSA:3.40.50.300
118-217 G3DSA:3.40.50.300

YDLLALEVNKEVRTIGIWGSAGVGKTTLARYIYAEIFVNFQTHVFLDNVENMKDKLLKFEGEEDPTVIISSYHDGHEITEARRKHRKILLIADDVNNMEQ

HMMSmart: SM00382
IPR003593
128-258 AAA,NBS
AAA+ ATPase domain

EVRTIGIWGSAGVGKTTLARYIYAEIFVNFQTHVFLDNVENMKDKLLKFEGEEDPTVIISSYHDGHEITEARRKHRKILLIADDVNNMEQGKWIIEYANWFAPGSRVILISQNKNLLVDAGVMDVYEVRSL

FPrintScan: PR00364
IPR000767
131-146 DISEASERSIST
Disease resistance protein

TIGIWGSAGVGKTTLA

FPrintScan: PR00364
IPR000767
199-213 DISEASERSIST
Disease resistance protein

RRKHRKILLIADDVN

Gene3D: G3DSA:3.40.50.300
240-270 G3DSA:3.40.50.300

NKNLLVDAGVMDVYEVRSLRYDEALQVFSHF

FPrintScan: PR00364
IPR000767
292-306 DISEASERSIST
Disease resistance protein

AGFLPLGLRLLGSFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox