PRGDB00050625 (loxc homologue)

From PRG Wiki
Jump to: navigation, search
loxc homologue
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2826843 (AJ002237)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum haplotype of the Cf-4/9 resistance gene locus.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCCGTTAAAACTTGATCTTCTAGAATTCAAGAACATGTTTACCGTTAATCCTAATGCTTCTGATTATTGTTACGACTATACAGACCAAAGGATGCAGTCATATCCAAGAACTCTTTTCTGGAACAAGAGTACAGATTGTTGCTCATGGGATGGCATTCATTGTGACGAGACGACAGGACAAGTGGTTGAGCTTGATCTCCGGTGCAGCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTAAAAAGGCTTGATTTGTCTTTTAATGATTTCACTGGATCGCTCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGGATTCTAATTTTACGGGTGTAATCCCTTCTGAAATCTCTCATCTTTCTAAACTACACGTTCTTCGTATCCATGATCTAAATGAGCTTAGTCTAGGGCCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCAACCTTGACTCGGTCAACATCTCTTCCACTATTCCTTCCAATTTCTCCTCTCATTTAACAAATCTATGGCTTCCATACACAGAGTTACGTGGGGTATTGCCTGAAAGAGTTTTCCACCTTTCCGACTTAGAATTCCTTCATTTATCATATAATCCCCAGCTCACAGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGAAGTTATATGTCCATAGTGTGAACATTGCTGATAGGATACCTGAATCATTTAGCCATCTAACTTCACTTCATGCGTTGTACATGGGTCGTTGTAATCTGTCAGGGCATATTCCTAAACCTCTATGGAATCTCACCAACATAGAGAGTTTGTTCCTTGGTGATAACCATCTTGAAGGACCAATTCCCCAGCTCACGAGATTTGAAAAGCTCAAGAGGTTATCACTTGGAAATAACAACTTACATGGTGGACTTGAGTTCTTATCCTTTAACAGAAGCTGGACCCAGCTTGAAATATTATATTTTTCGTCCAATTACCTTACTGGTCCAATTCCATCCAACGTAAGCGGACTTCAAAACCTAGGATGGCTCTTCTTGTCATCAAACCACTTGAATGGGAGTATACCTTCCTGGATATTCTCCCTTCCTTCACTGGTTGTGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAAGTACCGTTACTCTAAAACAAAATCAGCTGGAAGGTCCTATTCCGAATTCACTCCTAAACCAGGAGAGCCTACAATTCCTTCTCCTTTCACACAATAATATTAGTGGATATATTTCATCATCTATCTGCAATCTGAAAACATTGATGGTGTTAGACTTGGGTAGTAACAATTTGGAGGGAACAATCCCACAATGCGTGGGTGAGAGGAACGAATACCTTTTGGATTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTATTGGAAACTCTTTCAAGGCCATTAGCTTGCACGGGAATAAGCTAACGGGGAAAGTCCCACGATCTTTGATCAATTGCAAGTATTTGAAACTACTTGATCTAGGTAACAATCAGTTGAATGACACATTTCCAAACTGGTTGGGATACCTATCTCAATTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAGTACAAACCTGTTTATGCGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGAATTTTGGGGAATTTGCAAACCATGAAGAAAATTGATGAGAATACAAGATTCCCAGAGTATATTTCTGATCAATATGAGATTTATTATGTTTATTTGACGACAATTACAACAAAGGGACAAGATTATGATTCTGTTAGAATTTTGGATTCTAACATGATTATCAATCTCTCAAAGAATAGATTTGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTATCTCGCAATGCCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAGAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTTGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGTTGATGATCAAGTGACAACTCCAGCAGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACACATAATTACTACGAGAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
Hcr9-0 Hcr9-0 [Solanum lycopersicum].

MGCVKLVFFMPLKLDLLEFKNMFTVNPNASDYCYDYTDQRMQSYPRTLFWNKSTDCCSWDGIHCDETTGQVVELDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSLISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRIHDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSYNPQLTVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHALYMGRCNLSGHIPKPLWNLTNIESLFLGDNHLEGPIPQLTRFEKLKRLSLGNNNLHGGLEFLSFNRSWTQLEILYFSSNYLTGPIPSNVSGLQNLGWLFLSSNHLNGSIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLSTVTLKQNQLEGPIPNSLLNQESLQFLLLSHNNISGYISSSICNLKTLMVLDLGSNNLEGTIPQCVGERNEYLLDLDLSNNRLSGTINTTFSIGNSFKAISLHGNKLTGKVPRSLINCKYLKLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGSTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKIDENTRFPEYISDQYEIYYVYLTTITTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSRNALEGHIPASFQNLSVLESLDLSSNRISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGVDDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
16-775 PTHR24420,FAMILY NOT NAMED

LLEFKNMFTVNPNASDYCYDYTDQRMQSYPRTLFWNKSTDCCSWDGIHCDETTGQVVELDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSLISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRIHDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSYNPQLTVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHALYMGRCNLSGHIPKPLWNLTNIESLFLGDNHLEGPIPQLTRFEKLKRLSLGNNNLHGGLEFLSFNRSWTQLEILYFSSNYLTGPIPSNVSGLQNLGWLFLSSNHLNGSIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLSTVTLKQNQLEGPIPNSLLNQESLQFLLLSHNNISGYISSSICNLKTLMVLDLGSNNLEGTIPQCVGERNEYLLDLDLSNNRLSGTINTTFSIGNSFKAISLHGNKLTGKVPRSLINCKYLKLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGSTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKIDENTRFPEYISDQYEIYYVYLTTITTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSRNALEGHIPASFQNLSVLESLDLSSNRISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGVDDQVTT

HMMPfam: PF08263
IPR013210
16-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

LLEFKNMFTVNPNASDYCYDYTDQRMQSYPRTLFWNKSTDCCSWDGIHCD

HMMPanther: PTHR24420:SF473
16-775 PTHR24420:SF473,SUBFAMILY NOT NAMED

LLEFKNMFTVNPNASDYCYDYTDQRMQSYPRTLFWNKSTDCCSWDGIHCDETTGQVVELDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSLISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRIHDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSYNPQLTVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHALYMGRCNLSGHIPKPLWNLTNIESLFLGDNHLEGPIPQLTRFEKLKRLSLGNNNLHGGLEFLSFNRSWTQLEILYFSSNYLTGPIPSNVSGLQNLGWLFLSSNHLNGSIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLSTVTLKQNQLEGPIPNSLLNQESLQFLLLSHNNISGYISSSICNLKTLMVLDLGSNNLEGTIPQCVGERNEYLLDLDLSNNRLSGTINTTFSIGNSFKAISLHGNKLTGKVPRSLINCKYLKLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGSTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKIDENTRFPEYISDQYEIYYVYLTTITTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSRNALEGHIPASFQNLSVLESLDLSSNRISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGVDDQVTT

Gene3D: G3DSA:3.80.10.10
50-332 G3DSA:3.80.10.10

WNKSTDCCSWDGIHCDETTGQVVELDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSLISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRIHDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSYNPQLTVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHALYMGRCNLSGHIPKPLWNLTNIESLFLGDNHLEGPIPQLTRFEKLKRLSLGNNNLHGGLE

superfamily: SSF52047
73-402 SSF52047,LRR

ELDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSLISPKFGEFSDLTHLDLSDSNFTGVIPSEISHLSKLHVLRIHDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSYNPQLTVRFPTTKWNSSASLMKLYVHSVNIADRIPESFSHLTSLHALYMGRCNLSGHIPKPLWNLTNIESLFLGDNHLEGPIPQLTRFEKLKRLSLGNNNLHGGLEFLSFNRSWTQLEILYFSSNYLTGPIPSNVSGLQNLGWLFLSSNHLNGSIPSWIFSLPSLVVLDLSNNTFS

HMMPfam: PF13516
94-109 LRR_6,Leucine Rich repeat

LSNLKRLDLSFNDFTG

HMMPfam: PF00560
IPR001611
122-143 LRR_1
Leucine-rich repeat

LTHLDLSDSNFTGVIPSEISHL

HMMPfam: PF13855
245-304 LRR_8,Leucine rich repeat

SLMKLYVHSVNIADRIPESFSHLTSLHALYMGRCNLSGHIPKPLWNLTNIESLFLGDNHL

Gene3D: G3DSA:3.80.10.10
338-494 G3DSA:3.80.10.10

RSWTQLEILYFSSNYLTGPIPSNVSGLQNLGWLFLSSNHLNGSIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLSTVTLKQNQLEGPIPNSLLNQESLQFLLLSHNNISGYISSSICNLKTLMVLDLGSNNLEGTIPQCVGERNEYLLDLDLSNN

HMMPfam: PF13855
342-399 LRR_8,Leucine rich repeat

QLEILYFSSNYLTGPIPSNVSGLQNLGWLFLSSNHLNGSIPSWIFSLPSLVVLDLSNN

superfamily: SSF52058
411-756 SSF52058,LRR

KTLSTVTLKQNQLEGPIPNSLLNQESLQFLLLSHNNISGYISSSICNLKTLMVLDLGSNNLEGTIPQCVGERNEYLLDLDLSNNRLSGTINTTFSIGNSFKAISLHGNKLTGKVPRSLINCKYLKLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGSTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKKIDENTRFPEYISDQYEIYYVYLTTITTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSRNALEGHIPASFQNLSVLESLDLSSNRISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGND

HMMPfam: PF00560
IPR001611
436-458 LRR_1
Leucine-rich repeat

SLQFLLLSHNNISGYISSSICNL

FPrintScan: PR00019
486-499 LEURICHRPT,Leucine-rich repeat signature

LLDLDLSNNRLSGT

Gene3D: G3DSA:3.80.10.10
495-611 G3DSA:3.80.10.10

RLSGTINTTFSIGNSFKAISLHGNKLTGKVPRSLINCKYLKLLDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGSTNLFMRLQILDLSSNGFSGNLPERILGNLQTMKK

HMMPfam: PF13516
531-551 LRR_6,Leucine Rich repeat

CKYLKLLDLGNNQLNDTFPNW

HMMPfam: PF00560
IPR001611
583-606 LRR_1
Leucine-rich repeat

RLQILDLSSNGFSGNLPERILGNL

Gene3D: G3DSA:3.80.10.10
655-765 G3DSA:3.80.10.10

INLSKNRFEGHIPSIIGDLVGLRTLNLSRNALEGHIPASFQNLSVLESLDLSSNRISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSK

HMMPfam: PF13855
675-734 LRR_8,Leucine rich repeat

GLRTLNLSRNALEGHIPASFQNLSVLESLDLSSNRISGEIPQQLASLTFLEVLNLSHNHL

FPrintScan: PR00019
721-734 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL


List of References

M Parniske, K E Hammond-Kosack, C Golstein, C M Thomas, D A Jones, K Harrison, B B Wulff, J D Jones
Novel disease resistance specificities result from sequence exchange between tandemly repeated genes at the Cf-4/9 locus of tomato.
Cell: 1997, 91(6);821-32
PubMed:9413991 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox