PRGDB00050634 (Pto-like receptor kinase resistance protein)

From PRG Wiki
Jump to: navigation, search
Pto-like receptor kinase resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 47498953 (AY583622)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Rosa roxburghii

Comment?

Rosa roxburghii clone STK7 Pto-like receptor kinase resistance protein gene, partial cds.

DNA Sequence

TAGGGGATGGTGGGTTTGGGAATGTTTATAGAGGGACTCTCTTGAATGGTACAAAAGTGGCAGTGAAGCGAGCTTATGAGCGAGATGAGCATGGATCAGGTTCAGGCCAAGGTCTCCCAGAATTCGAAACAGAAATCATAGTGTTGTCGAAAATCCGCCACCGCCATCTTGTCTCCTTAATTGGTTACTGTAATGAAAGGTCTGAGATGATACTAGTGTATGAGTTCATGGAAAAAGGGACCTTGAGAGATCATTTGTATGATTCGGATGTGCCTCGCTTGTCATGGAAGCAAAGACTTGAAATTTGTACTGGTGCAGCAAGGGGTCTTCATTATCTCCACACAGGTGCAGCTGGGGGAATCATTCACCGTGATGTCAAGTCCACCAACATATTGCTTGATGCAAACCATGTTGCCAAAGTTGCTGACTTTGGCCTTTCGAGATCTGGAGCTCTCGATGAAACGCATGTCAGCACTAATGTTAAAGGCACTTTTGGTTATCTTGATCCTGAGTACATGATGTCTGAACAGTTGACAGAAAAATCTGATGTCTACTCATTTGGTGT


Protein sequences

Name Description Sequence
Pto-like receptor kinase resistance protein Pto-like receptor kinase resistance protein [Rosa roxburghii].

GDGGFGNVYRGTLLNGTKVAVKRAYERDEHGSGSGQGLPEFETEIIVLSKIRHRHLVSLIGYCNERSEMILVYEFMEKGTLRDHLYDSDVPRLSWKQRLEICTGAARGLHYLHTGAAGGIIHRDVKSTNILLDANHVAKVADFGLSRSGALDETHVSTNVKGTFGYLDPEYMMSEQLTEKSDVYSFGV

Domains

Domain Start-End Description Sequence

HMMPfam: PF07714
IPR001245
1-188 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

GDGGFGNVYRGTLLNGTKVAVKRAYERDEHGSGSGQGLPEFETEIIVLSKIRHRHLVSLIGYCNERSEMILVYEFMEKGTLRDHLYDSDVPRLSWKQRLEICTGAARGLHYLHTGAAGGIIHRDVKSTNILLDANHVAKVADFGLSRSGALDETHVSTNVKGTFGYLDPEYMMSEQLTEKSDVYSFGV

HMMPanther: PTHR24420
1-188 PTHR24420,FAMILY NOT NAMED

GDGGFGNVYRGTLLNGTKVAVKRAYERDEHGSGSGQGLPEFETEIIVLSKIRHRHLVSLIGYCNERSEMILVYEFMEKGTLRDHLYDSDVPRLSWKQRLEICTGAARGLHYLHTGAAGGIIHRDVKSTNILLDANHVAKVADFGLSRSGALDETHVSTNVKGTFGYLDPEYMMSEQLTEKSDVYSFGV

Gene3D: G3DSA:3.30.200.20
1-61 G3DSA:3.30.200.20

GDGGFGNVYRGTLLNGTKVAVKRAYERDEHGSGSGQGLPEFETEIIVLSKIRHRHLVSLIG

ProfileScan: PS50011
IPR000719
1-188 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GDGGFGNVYRGTLLNGTKVAVKRAYERDEHGSGSGQGLPEFETEIIVLSKIRHRHLVSLIGYCNERSEMILVYEFMEKGTLRDHLYDSDVPRLSWKQRLEICTGAARGLHYLHTGAAGGIIHRDVKSTNILLDANHVAKVADFGLSRSGALDETHVSTNVKGTFGYLDPEYMMSEQLTEKSDVYSFGV

superfamily: SSF56112
IPR011009
1-188 Kinase_like
Protein kinase-like domain

GDGGFGNVYRGTLLNGTKVAVKRAYERDEHGSGSGQGLPEFETEIIVLSKIRHRHLVSLIGYCNERSEMILVYEFMEKGTLRDHLYDSDVPRLSWKQRLEICTGAARGLHYLHTGAAGGIIHRDVKSTNILLDANHVAKVADFGLSRSGALDETHVSTNVKGTFGYLDPEYMMSEQLTEKSDVYSFGV

HMMPanther: PTHR24420:SF785
1-188 PTHR24420:SF785

GDGGFGNVYRGTLLNGTKVAVKRAYERDEHGSGSGQGLPEFETEIIVLSKIRHRHLVSLIGYCNERSEMILVYEFMEKGTLRDHLYDSDVPRLSWKQRLEICTGAARGLHYLHTGAAGGIIHRDVKSTNILLDANHVAKVADFGLSRSGALDETHVSTNVKGTFGYLDPEYMMSEQLTEKSDVYSFGV

Gene3D: G3DSA:1.10.510.10
62-188 G3DSA:1.10.510.10

YCNERSEMILVYEFMEKGTLRDHLYDSDVPRLSWKQRLEICTGAARGLHYLHTGAAGGIIHRDVKSTNILLDANHVAKVADFGLSRSGALDETHVSTNVKGTFGYLDPEYMMSEQLTEKSDVYSFGV

PatternScan: PS00108
IPR008271
120-132 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox