PRGDB00050636 (RGA2)

From PRG Wiki
Jump to: navigation, search
RGA2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 46948262 (AY550176)
Gene Class N
Domain Type NBS
Gene Species Triticum aestivum

Comment?

Triticum aestivum cultivar Xinong88 RGA protein (RGA2) gene, partial cds.

DNA Sequence

TGATACTGGATGATGTCTGGTGCAATGCGGATGTTGGTAACCAGGAGCTACCAAAGTTACTTTCTCCACTTAAGAAAGGAAAGAAAGAAAGCAAGATCCTAGTGACAACTCGAAGTAAATATGCACTACCGGATCTATGTCCTGGTGTGAGATATACTGCCATGCCGATAACTGAGGTTGATGATACCGCCTTCTTTGAGCTGTTCATGCATTATGCCCTCGAAGATGGCCAAGATCAAAGCATGTTCCAGAACATTGGGGTTGAGATTGCAAAAAAGCTGAAGGGGTCACCTCTAGCAGCTAGAACAGTGGGTGGAAATTTACGTCGACAGCAAGATGTTGACCATTGGAGAAGAGTCGGAGATCAAGACCTTTTCAAGGTATGGACGGGACCTCTGTGGTGGAGCTACTATCAGCTAGGTGAGCAGGCTAGGCGTTGCTTTGCTTACTGCAGTATTTTTCCTAGGAGACATCGCTTGTACTGTGATGAATTAGTTAGACTCTGGATGGCAGAAGGGTTCATAAGAAGCAC


Protein sequences

Name Description Sequence
RGA protein RGA protein [Triticum aestivum].

ILDDVWCNADVGNQELPKLLSPLKKGKKESKILVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWTGPLWWSYYQLGEQARRCFAYCSIFPRRHRLYCDELVRLWMAEGFIRST


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-129 SSF52540

ILDDVWCNADVGNQELPKLLSPLKKGKKESKILVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWT

HMMPfam: PF00931
IPR002182
1-175 NB-ARC,NBS
NB-ARC

ILDDVWCNADVGNQELPKLLSPLKKGKKESKILVTTRSKYALPDLCPGVRYTAMPITEVDDTAFFELFMHYALEDGQDQSMFQNIGVEIAKKLKGSPLAARTVGGNLRRQQDVDHWRRVGDQDLFKVWTGPLWWSYYQLGEQARRCFAYCSIFPRRHRLYCDELVRLWMAEGFIR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox