PRGDB00050638 (RPP13-like protein)

From PRG Wiki
Jump to: navigation, search
RPP13-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 46410121 (AY487232)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis arenosa

Comment?

Arabidopsis arenosa isolate Aren3 RPP13-like protein gene, partial cds.

DNA Sequence

AGTACCGGGAAAGATCGGCAGCTATCTCATCGAAGAAGCGCCAATGTTGATTGGAGTCAAAGAAGATCTAGAGGAGCTAAAGACAGAGTTGACGTGCATCCAAGTTTATCTCAAGGATGTTGAAGCTTGTGACAGAGAAGATGAGGTCTCAAAAGAGTGGACAAAACTGGTTTTAGACATCGCTTATGATGTCGAAGATGTTTTGGACACCTATTTTCTGAAACTCGGAAAAAGACCACAAAGGCGAGGCCTCAAGAGATGGACGACCAACATAACAGGCGAGAAGAAGGATGCGTACAACATAGTTGATGATATCAGAACCCTCAAACAAAGAATGTTGGATCTTACTCGCAAGCGGGAGGCGTATGGCATAGGAATAGGAAACTATAGTGAGCATCAAGCAGTAGCGTGTACTTCAAGGGTGATGGAGCTTCGGTGTCCTCGATCTGATGATCAGGAAGAGCGTGTAGTTGATTTGGAAGATGATGCTAAGGTTCTTTTGACAAAGCTTCTTGACGATGATGGGGATAACAAGACATATATGATCTCCATATTTGGCATGGGAGGTCTCCAAACCACTGCTCTTGCTAGGAAGCTTTATAACTCTAGCTATGTGAAGGAAAGTTTTGAATATCGCGTATGGACTTATGTTTCTCGAGAATGTAAAACAGGAGATATTCTTAAGAGAATCATAAGATCGTTGGGAGAAACATCTGAGGTAGAGCTTGAAAAGATGGCGGAGGAGGAGTTAGAAGTTTACCTTAATGATATTTTACAAGGAAAAAAATATTTGGTGGTGGTAGATGATATATGGGAGAAAGAAGCGTGGGAGAGCTTGAAGAGAGCGTTACCTTGCAATTCTGAAGGAAGTAGAGTCATCATCACTACATGTAATAGAGCCGTGGCTGAAGGCGCAGACCAAAGAGTCTACACCCATAACATAAGGTTCTTAACGTTTCAAGAAAGCTGGAACTTGTTTGAGAAGAAAGCATTTAGAGATATTGTAACGGTCGATCAAGAACTTCAGAAAATCGGAAAAGAATTGGTTCACAAATGCGGTGGATTACCGCTTACTACAGTCGTGCTTGCTGGGCTAATGTCTAGGAAGAGTCCAAACGAGTGGAAAGATGTGTGGGAGAATTTGCGCGTAAAGGATGATCACATTCATGTCTCCACTGTGTTTGATCTAAGCTTCAAGGAGATGCAAAATGAGTTAAAACTCTGTTTTCTTTACGTTAGTGTCTTCCCGGAGGACTATGAGATCGACGTAGAGAAATTGATACAAGTACTTGTAGCAGAAGGATTTATACAAGATGAAAAAGAGATGATGATGGAAGATGTGACACGGTATTATATCGAAGAACTGATTGACAGAAGCTTAGTGGAAGTCGTGAAAAGAAAGAGAGGGAAACTAATGTCTTTTAGAATCCATGATCTTCTAAGAGAATTGGCTATCAAGAAAGCCAAAGAGCTCAACTTTGTAACTGTTTACAACGAGCATCATTCTTCTACTACTTGTAGAAGGGAAGTGGTTCACCATCTTATGGACAACAACTACTTGTGCGACAGACGTGTGAACAAACAAATGCGATCCTTCTTGTTTTTCGGTGAACGGAGGAGCGACATTACTTATGTTGAAACCGTTACTTTGAAACTGAAGTTACTTCGAGTGCTTAATCTTGGAGGACTTCATTTTATTTGTCAAGGATATAGCCCTTGGAGTTTACCAGATGTGATCGGAGGTTTAGTCCACTTGAGGTACCTTGGGATAGCCGATACGGTTGTGAACAATTTACCAGATTTCATCTCCAACTTA


Protein sequences

Name Description Sequence
RPP13-like protein RPP13-like protein [Arabidopsis arenosa].

VPGKIGSYLIEEAPMLIGVKEDLEELKTELTCIQVYLKDVEACDREDEVSKEWTKLVLDIAYDVEDVLDTYFLKLGKRPQRRGLKRWTTNITGEKKDAYNIVDDIRTLKQRMLDLTRKREAYGIGIGNYSEHQAVACTSRVMELRCPRSDDQEERVVDLEDDAKVLLTKLLDDDGDNKTYMISIFGMGGLQTTALARKLYNSSYVKESFEYRVWTYVSRECKTGDILKRIIRSLGETSEVELEKMAEEELEVYLNDILQGKKYLVVVDDIWEKEAWESLKRALPCNSEGSRVIITTCNRAVAEGADQRVYTHNIRFLTFQESWNLFEKKAFRDIVTVDQELQKIGKELVHKCGGLPLTTVVLAGLMSRKSPNEWKDVWENLRVKDDHIHVSTVFDLSFKEMQNELKLCFLYVSVFPEDYEIDVEKLIQVLVAEGFIQDEKEMMMEDVTRYYIEELIDRSLVEVVKRKRGKLMSFRIHDLLRELAIKKAKELNFVTVYNEHHSSTTCRREVVHHLMDNNYLCDRRVNKQMRSFLFFGERRSDITYVETVTLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
7-605 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SYLIEEAPMLIGVKEDLEELKTELTCIQVYLKDVEACDREDEVSKEWTKLVLDIAYDVEDVLDTYFLKLGKRPQRRGLKRWTTNITGEKKDAYNIVDDIRTLKQRMLDLTRKREAYGIGIGNYSEHQAVACTSRVMELRCPRSDDQEERVVDLEDDAKVLLTKLLDDDGDNKTYMISIFGMGGLQTTALARKLYNSSYVKESFEYRVWTYVSRECKTGDILKRIIRSLGETSEVELEKMAEEELEVYLNDILQGKKYLVVVDDIWEKEAWESLKRALPCNSEGSRVIITTCNRAVAEGADQRVYTHNIRFLTFQESWNLFEKKAFRDIVTVDQELQKIGKELVHKCGGLPLTTVVLAGLMSRKSPNEWKDVWENLRVKDDHIHVSTVFDLSFKEMQNELKLCFLYVSVFPEDYEIDVEKLIQVLVAEGFIQDEKEMMMEDVTRYYIEELIDRSLVEVVKRKRGKLMSFRIHDLLRELAIKKAKELNFVTVYNEHHSSTTCRREVVHHLMDNNYLCDRRVNKQMRSFLFFGERRSDITYVETVTLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNL

HMMPanther: PTHR11017:SF14
7-605 PTHR11017:SF14

SYLIEEAPMLIGVKEDLEELKTELTCIQVYLKDVEACDREDEVSKEWTKLVLDIAYDVEDVLDTYFLKLGKRPQRRGLKRWTTNITGEKKDAYNIVDDIRTLKQRMLDLTRKREAYGIGIGNYSEHQAVACTSRVMELRCPRSDDQEERVVDLEDDAKVLLTKLLDDDGDNKTYMISIFGMGGLQTTALARKLYNSSYVKESFEYRVWTYVSRECKTGDILKRIIRSLGETSEVELEKMAEEELEVYLNDILQGKKYLVVVDDIWEKEAWESLKRALPCNSEGSRVIITTCNRAVAEGADQRVYTHNIRFLTFQESWNLFEKKAFRDIVTVDQELQKIGKELVHKCGGLPLTTVVLAGLMSRKSPNEWKDVWENLRVKDDHIHVSTVFDLSFKEMQNELKLCFLYVSVFPEDYEIDVEKLIQVLVAEGFIQDEKEMMMEDVTRYYIEELIDRSLVEVVKRKRGKLMSFRIHDLLRELAIKKAKELNFVTVYNEHHSSTTCRREVVHHLMDNNYLCDRRVNKQMRSFLFFGERRSDITYVETVTLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNL

superfamily: SSF52540
139-381 SSF52540

SRVMELRCPRSDDQEERVVDLEDDAKVLLTKLLDDDGDNKTYMISIFGMGGLQTTALARKLYNSSYVKESFEYRVWTYVSRECKTGDILKRIIRSLGETSEVELEKMAEEELEVYLNDILQGKKYLVVVDDIWEKEAWESLKRALPCNSEGSRVIITTCNRAVAEGADQRVYTHNIRFLTFQESWNLFEKKAFRDIVTVDQELQKIGKELVHKCGGLPLTTVVLAGLMSRKSPNEWKDVWENL

HMMPfam: PF00931
IPR002182
162-440 NB-ARC,NBS
NB-ARC

DAKVLLTKLLDDDGDNKTYMISIFGMGGLQTTALARKLYNSSYVKESFEYRVWTYVSRECKTGDILKRIIRSLGETSEVELEKMAEEELEVYLNDILQGKKYLVVVDDIWEKEAWESLKRALPCNSEGSRVIITTCNRAVAEGADQRVYTHNIRFLTFQESWNLFEKKAFRDIVTVDQELQKIGKELVHKCGGLPLTTVVLAGLMSRKSPNEWKDVWENLRVKDDHIHVSTVFDLSFKEMQNELKLCFLYVSVFPEDYEIDVEKLIQVLVAEGFIQDEK

FPrintScan: PR00364
IPR000767
181-196 DISEASERSIST
Disease resistance protein

MISIFGMGGLQTTALA

FPrintScan: PR00364
IPR000767
257-271 DISEASERSIST
Disease resistance protein

ILQGKKYLVVVDDIW

FPrintScan: PR00364
IPR000767
352-366 DISEASERSIST
Disease resistance protein

CGGLPLTTVVLAGLM

superfamily: SSF52058
475-605 SSF52058,LRR

RIHDLLRELAIKKAKELNFVTVYNEHHSSTTCRREVVHHLMDNNYLCDRRVNKQMRSFLFFGERRSDITYVETVTLKLKLLRVLNLGGLHFICQGYSPWSLPDVIGGLVHLRYLGIADTVVNNLPDFISNL

FPrintScan: PR00364
IPR000767
550-566 DISEASERSIST
Disease resistance protein

LKLKLLRVLNLGGLHFI


List of References

Laura E Rose, Peter D Bittner-Eddy, Charles H Langley, Eric B Holub, Richard W Michelmore, Jim L Beynon
The maintenance of extreme amino acid diversity at the disease resistance gene, RPP13, in Arabidopsis thaliana.
Genetics: 2004, 166(3);1517-27
PubMed:15082565 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox