PRGDB00050639 (RPP13-like protein)

From PRG Wiki
Jump to: navigation, search
RPP13-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 46410119 (AY487231)
Gene Class CNL
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis arenosa

Comment?

Arabidopsis arenosa isolate Aren2 RPP13-like protein gene, partial cds.

DNA Sequence

AGAAGAATGAGATTAACGTAGAGAAGTTGATACGGTTACTTGTGGCAGAAGGGTTTATAGAAGAGGATAAAGAGATGATGGAAGATGTGGCTCGGTCTTATATCGAAGAGCTGATAGACAGAAGCTTGGTGAAAGCTGAAAGAATAGAGAGAGGAAAGGTGATTACTTGTAAAGTCCATGATCTTCTGAGAGACGTGGCTATCAAGAAAGCCAAAGAGCTCAACTTTGTACACGTTTATAACGACCCGGTGGCCCAATATTCTTCTGCTACTTGCAGAAGGGAAGTGGTTCACCATCAGATCAATAGATACTTATCTGAGAAACACCGGAACAAACGGATGCGATCCTTCTTATTCTTTGGAGAATCAGAGGATTTGGTAGGGCGTGATTTCGAAACCATTTACTTAAAACTGAAGCTACTTCGAGTGCTTGATCTCGGAGGGGTTCGGTTTCCTTGTGAAGAAGGGAAGAAGAGTTTACCAGAAGTGATTGGGGATCTGATCCACTTGAGGTACCTTGGAATTGCTGATACTTTTCTCAGCAATTTACCAGCTTTTATCTCCAACTTACGGTTTCTACAAACACTAGATGCATCTGGCAATGAATCCATCAGGCAAACAATCGATCTTAGTAAGCTCACATCACTGAGACATGTCATAGGAAAATTCGTTGGAGAATTACTACTAGGCGACACCGTTAACCTTCAGACCTTGAGGTCTATCTCCTCCTACAGCTGGAGTAAACTAAACCATGAGGTTTTCATAAATCTTCGGGACTTGGAAATCTTTGATTCCATGTGGGTGGATCAGAGAGGAGTTTCTTTGGACTTGGCTTCCTTCTCTAAACTGAAAAATCTTCGTGCCTTGACGCTAAAGGTATCCACCTTCAAGTTATCTTCAGAATCGGAAGAAACAGTTCGGTTCCAAACCCTTGTTGAGCTGACACTGCGTTGCGATATAAGGAGACTTCCCAAGGATATGGATGTGATCTTTCCTAGTCTTGAGTCACTTACACTTGTCAGATTACGTCTCGAGGAAGATCCAATGCCTGCTTTGGAGAAATTGCAGAGACTAGAAGATCTGTCACTGACAAATTGTAGTTACTCGGAAGCAAAGATGAGCATCAGCGCACAAGGTTTTAGTCGGCTGAACAAGCTTGAATTGTTCATGGTAAGATTAGACGAGTTGCATATAGAAGAAGAG


Protein sequences

Name Description Sequence
RPP13-like protein RPP13-like protein [Arabidopsis arenosa].

KNEINVEKLIRLLVAEGFIEEDKEMMEDVARSYIEELIDRSLVKAERIERGKVITCKVHDLLRDVAIKKAKELNFVHVYNDPVAQYSSATCRREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIHLRYLGIADTFLSNLPAFISNLRFLQTLDASGNESIRQTIDLSKLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGVSLDLASFSKLKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLVRLRLEEDPMPALEKLQRLEDLSLTNCSYSEAKMSISAQGFSRLNKLELFMVRLDELHIEEE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
3-400 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EINVEKLIRLLVAEGFIEEDKEMMEDVARSYIEELIDRSLVKAERIERGKVITCKVHDLLRDVAIKKAKELNFVHVYNDPVAQYSSATCRREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIHLRYLGIADTFLSNLPAFISNLRFLQTLDASGNESIRQTIDLSKLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGVSLDLASFSKLKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLVRLRLEEDPMPALEKLQRLEDLSLTNCSYSEAKMSISAQGFSRLNKLELFMVRLDELHIEEE

HMMPanther: PTHR11017:SF14
3-400 PTHR11017:SF14

EINVEKLIRLLVAEGFIEEDKEMMEDVARSYIEELIDRSLVKAERIERGKVITCKVHDLLRDVAIKKAKELNFVHVYNDPVAQYSSATCRREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIHLRYLGIADTFLSNLPAFISNLRFLQTLDASGNESIRQTIDLSKLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGVSLDLASFSKLKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLVRLRLEEDPMPALEKLQRLEDLSLTNCSYSEAKMSISAQGFSRLNKLELFMVRLDELHIEEE

superfamily: SSF52058
57-396 SSF52058,LRR

KVHDLLRDVAIKKAKELNFVHVYNDPVAQYSSATCRREVVHHQINRYLSEKHRNKRMRSFLFFGESEDLVGRDFETIYLKLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIHLRYLGIADTFLSNLPAFISNLRFLQTLDASGNESIRQTIDLSKLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGVSLDLASFSKLKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLVRLRLEEDPMPALEKLQRLEDLSLTNCSYSEAKMSISAQGFSRLNKLELFMVRLDELH

Gene3D: G3DSA:3.80.10.10
136-389 G3DSA:3.80.10.10

KLKLLRVLDLGGVRFPCEEGKKSLPEVIGDLIHLRYLGIADTFLSNLPAFISNLRFLQTLDASGNESIRQTIDLSKLTSLRHVIGKFVGELLLGDTVNLQTLRSISSYSWSKLNHEVFINLRDLEIFDSMWVDQRGVSLDLASFSKLKNLRALTLKVSTFKLSSESEETVRFQTLVELTLRCDIRRLPKDMDVIFPSLESLTLVRLRLEEDPMPALEKLQRLEDLSLTNCSYSEAKMSISAQGFSRLNKLELFM


List of References

Laura E Rose, Peter D Bittner-Eddy, Charles H Langley, Eric B Holub, Richard W Michelmore, Jim L Beynon
The maintenance of extreme amino acid diversity at the disease resistance gene, RPP13, in Arabidopsis thaliana.
Genetics: 2004, 166(3);1517-27
PubMed:15082565 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox