PRGDB00050640 (RPP13-like protein)

From PRG Wiki
Jump to: navigation, search
RPP13-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 46410117 (AY487230)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis arenosa

Comment?

Arabidopsis arenosa isolate Aren1 RPP13-like protein gene, partial cds.

DNA Sequence

AGTTCGTTGTGGGAAAGATCGGCAACTATCTCATTGAAGAAGCATCAATGTTGATTGGAGTCAAAGACGATCTAGAGGAGCTGAAGACRGAGTTGACGTGCATCCAAGGTTATCTCAAGGAYGTTGAAGCTCGAGAAAGAGAAGATGAAGTCTCAAAAGAGTGGACAAAACTAGTTTTAGATATCGCTTATGACGTCGAGGATGTTTTGGACACCTACCACATGAAACTCGAAGAAAGATCAAAAAGGCGAGGCGTCAAGAGATGGACCAACAAGATAGGCAGGAAGATAGATGCGTACAACATAATTGATGATATCAGAATCCTCAAGAGAAGAATCTTGGATATCACTCGCAAGAGGGAGACTTATGGTATAGGAGGCTTAAAAGAGCCTCAAGGAGGAGGGAATATTTCAAGTTTGAGAGTTAGGCAGCTTCGGCGTGCCCTATCTGTTGATCAAGAAGAGCTTGTAGTTGGTTTGGAAGATGATGCTAAGATTCTTTTGGCAAAGCTTCTCGATGTTAGAGAGTACAATAGATTTATTATCTCGATCTTCGGTATGGGAGGCCTCGGAAAGACTGCACTTGCTAGGAAGCTTTACAACTCAGGGGATGTGAAGAGAAGATTTGATTGCCGTGCGTGGACCTATGTTTCTCAAGAGTATAAAACTGGAGATATACTTGTGAGAATCATTAGATCTTTGGGAATGACTTCAGGGGAAGAGTTGGAAAATATCAGAAAGTTTGCAGAGGAGGAACTAGAAGTTTACCTTCACGGTCTTCTAGAAGGGAAAAAATATTTGGTGGTGGTGGATGATATATGGGAGCGAGAAGCGTGGGAGAGCTTAAAGAGAGCGTTACCTTGCAACCATGAAGGAAGTAAAGTCATCATCACWACGCGTATTAGAGCCGTGGCTGAAGGCGTGGACGGGAGATTCTATGCTCATAAGTTAAGGTTCTTGACGTTTGAGGAAAGCTGGAAGTTGTTTGAACAGAAAGYATTCASRAATATGGAATGGGTTGATGAAGATTTGCTGAAAACYGGAAAAGAAATGGTTCAAAAATGCAGAGGATTACCACTTTGTATAGTCGTTCTTGCGGGGCTTTTGTCGAGGAAGAGACCAAGTGAGTGGAATGATGTGTGTAACAGTTTATGGAGACGCCTAAAGGATGACTCCATTCATGTTTCCACTGTGTTTGATCTAAGCTTCAAGGATATGCGGCATGAGTCCAAACTCTGTTTTCTGTACCTTAGTATCTTCCCTGAGGACCACGAGATAGATATAGAGAAGTTGATATGGTTACTTGTAGCAGAAGGGTTTATAAAAGAGGATGAAGAGATGAAGATGGAAGATGTGGCTCGGTACTACATCGAAGAGCTGATAGACAGAAGCTTACTGGAAGCAGTGAGAAGAGAAAGAGGAAAAGTGATGTCTTGTAGAATCCATGATCTTCTTAGAGATGTGGCTATCGAGAAATCTAAAGAGCTCAACTTTGTAAACGTTTATAACGATCATGTGGCCCAACATTCTTCTACTACTTGCAGAAGGGAAGTGGTTCACCATCAGATCAATAGATACTTATCTGAGAAACACTGGAACAAACGGATGCGATCCTTCTTATTCTTTGGAGAATCAAGGGATTCACGTGATCTTGAAACCATTTACTTACAACTGAAGCTACTTCGAGTGCTTGATCTCGGAGGGGTTCGGTTTGCTTGGGAAGAAGGGAAGAGGAGTTTACCAGAAGTGATTGGGGATCTGATCCACTTGAGGTACCTTGGAATTGCTGATACTTTTCTCAGCAATTTTCCATCTTTTATCTCCAACTTACGGTTTCTACAAACACTAGATTCATCTGGCAATGAATCCAAAGTCGATCTCCGTCATATCACATCATTAAGACATGTCATAGGAAATTTCGCTGGAGGACTATTATTAGGCGAAAGCGTTAACCTTCAGACCTTGAGGGCTATCTCCGCTGACAGCTGGAGCAAACTAAAACATGAGTTGCTCATAAATCTTCGGGACTTGGAGATCTATGTAGGTTTTGCTACAGTGGAGAGAGGAGTTCCTGTGAGATGGGCTTCCTTGACTAAACTGAGAAATCTTCGTGTTTTGAGGCTGCATTCTGACGATATCCCTTTATCATTGGAATCGGAAGAAGCAGTTAGGTCCATGGATGTTATCTCTCCCAGTCTTGAATCTGTGACATTTTTTGGAATATATCTCAAGGAAGACCCAATGCCTTTTTTCCAGAAAATGCCGAGACTTGAAGATCTGATCTTGGAAAATTGTTATTACTCGGGAGAGAAGATAAGTGTCAGCGAACAAGGTTTTGGTAGGCTGAGGAAGCTTCAATTGTACATGGAAAGTTTAGATGAGTTGCAGATCGAAGAAGAG


Protein sequences

Name Description Sequence
RPP13-like protein RPP13-like protein [Arabidopsis arenosa].

FVVGKIGNYLIEEASMLIGVKDDLEELKTELTCIQGYLKDVEAREREDEVSKEWTKLVLDIAYDVEDVLDTYHMKLEERSKRRGVKRWTNKIGRKIDAYNIIDDIRILKRRILDITRKRETYGIGGLKEPQGGGNISSLRVRQLRRALSVDQEELVVGLEDDAKILLAKLLDVREYNRFIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILVRIIRSLGMTSGEELENIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSKVIITTRIRAVAEGVDGRFYAHKLRFLTFEESWKLFEQKXFXNMEWVDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKRPSEWNDVCNSLWRRLKDDSIHVSTVFDLSFKDMRHESKLCFLYLSIFPEDHEIDIEKLIWLLVAEGFIKEDEEMKMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIEKSKELNFVNVYNDHVAQHSSTTCRREVVHHQINRYLSEKHWNKRMRSFLFFGESRDSRDLETIYLQLKLLRVLDLGGVRFAWEEGKRSLPEVIGDLIHLRYLGIADTFLSNFPSFISNLRFLQTLDSSGNESKVDLRHITSLRHVIGNFAGGLLLGESVNLQTLRAISADSWSKLKHELLINLRDLEIYVGFATVERGVPVRWASLTKLRNLRVLRLHSDDIPLSLESEEAVRSMDVISPSLESVTFFGIYLKEDPMPFFQKMPRLEDLILENCYYSGEKISVSEQGFGRLRKLQLYMESLDELQIEEE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
6-799 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGNYLIEEASMLIGVKDDLEELKTELTCIQGYLKDVEAREREDEVSKEWTKLVLDIAYDVEDVLDTYHMKLEERSKRRGVKRWTNKIGRKIDAYNIIDDIRILKRRILDITRKRETYGIGGLKEPQGGGNISSLRVRQLRRALSVDQEELVVGLEDDAKILLAKLLDVREYNRFIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILVRIIRSLGMTSGEELENIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSKVIITTRIRAVAEGVDGRFYAHKLRFLTFEESWKLFEQKXFXNMEWVDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKRPSEWNDVCNSLWRRLKDDSIHVSTVFDLSFKDMRHESKLCFLYLSIFPEDHEIDIEKLIWLLVAEGFIKEDEEMKMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIEKSKELNFVNVYNDHVAQHSSTTCRREVVHHQINRYLSEKHWNKRMRSFLFFGESRDSRDLETIYLQLKLLRVLDLGGVRFAWEEGKRSLPEVIGDLIHLRYLGIADTFLSNFPSFISNLRFLQTLDSSGNESKVDLRHITSLRHVIGNFAGGLLLGESVNLQTLRAISADSWSKLKHELLINLRDLEIYVGFATVERGVPVRWASLTKLRNLRVLRLHSDDIPLSLESEEAVRSMDVISPSLESVTFFGIYLKEDPMPFFQKMPRLEDLILENCYYSGEKISVSEQGFGRLRKLQLYMESLDELQIEEE

HMMPanther: PTHR11017:SF14
6-799 PTHR11017:SF14

IGNYLIEEASMLIGVKDDLEELKTELTCIQGYLKDVEAREREDEVSKEWTKLVLDIAYDVEDVLDTYHMKLEERSKRRGVKRWTNKIGRKIDAYNIIDDIRILKRRILDITRKRETYGIGGLKEPQGGGNISSLRVRQLRRALSVDQEELVVGLEDDAKILLAKLLDVREYNRFIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILVRIIRSLGMTSGEELENIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSKVIITTRIRAVAEGVDGRFYAHKLRFLTFEESWKLFEQKXFXNMEWVDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKRPSEWNDVCNSLWRRLKDDSIHVSTVFDLSFKDMRHESKLCFLYLSIFPEDHEIDIEKLIWLLVAEGFIKEDEEMKMEDVARYYIEELIDRSLLEAVRRERGKVMSCRIHDLLRDVAIEKSKELNFVNVYNDHVAQHSSTTCRREVVHHQINRYLSEKHWNKRMRSFLFFGESRDSRDLETIYLQLKLLRVLDLGGVRFAWEEGKRSLPEVIGDLIHLRYLGIADTFLSNFPSFISNLRFLQTLDSSGNESKVDLRHITSLRHVIGNFAGGLLLGESVNLQTLRAISADSWSKLKHELLINLRDLEIYVGFATVERGVPVRWASLTKLRNLRVLRLHSDDIPLSLESEEAVRSMDVISPSLESVTFFGIYLKEDPMPFFQKMPRLEDLILENCYYSGEKISVSEQGFGRLRKLQLYMESLDELQIEEE

superfamily: SSF52540
139-390 SSF52540

LRVRQLRRALSVDQEELVVGLEDDAKILLAKLLDVREYNRFIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILVRIIRSLGMTSGEELENIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSKVIITTRIRAVAEGVDGRFYAHKLRFLTFEESWKLFEQKXFXNMEWVDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKRPSEWNDVCNSLWRRLKDD

HMMPfam: PF00931
IPR002182
166-443 NB-ARC,NBS
NB-ARC

LLAKLLDVREYNRFIISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILVRIIRSLGMTSGEELENIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSKVIITTRIRAVAEGVDGRFYAHKLRFLTFEESWKLFEQKXFXNMEWVDEDLLKTGKEMVQKCRGLPLCIVVLAGLLSRKRPSEWNDVCNSLWRRLKDDSIHVSTVFDLSFKDMRHESKLCFLYLSIFPEDHEIDIEKLIWLLVAEGFIKED

Gene3D: G3DSA:3.40.50.300
180-311 G3DSA:3.40.50.300

IISIFGMGGLGKTALARKLYNSGDVKRRFDCRAWTYVSQEYKTGDILVRIIRSLGMTSGEELENIRKFAEEELEVYLHGLLEGKKYLVVVDDIWEREAWESLKRALPCNHEGSKVIITTRIRAVAEGVDGRF

FPrintScan: PR00364
IPR000767
180-195 DISEASERSIST
Disease resistance protein

IISIFGMGGLGKTALA

FPrintScan: PR00364
IPR000767
259-273 DISEASERSIST
Disease resistance protein

LLEGKKYLVVVDDIW

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

CRGLPLCIVVLAGLL

superfamily: SSF52058
479-795 SSF52058,LRR

RIHDLLRDVAIEKSKELNFVNVYNDHVAQHSSTTCRREVVHHQINRYLSEKHWNKRMRSFLFFGESRDSRDLETIYLQLKLLRVLDLGGVRFAWEEGKRSLPEVIGDLIHLRYLGIADTFLSNFPSFISNLRFLQTLDSSGNESKVDLRHITSLRHVIGNFAGGLLLGESVNLQTLRAISADSWSKLKHELLINLRDLEIYVGFATVERGVPVRWASLTKLRNLRVLRLHSDDIPLSLESEEAVRSMDVISPSLESVTFFGIYLKEDPMPFFQKMPRLEDLILENCYYSGEKISVSEQGFGRLRKLQLYMESLDELQ

FPrintScan: PR00364
IPR000767
555-571 DISEASERSIST
Disease resistance protein

LQLKLLRVLDLGGVRFA

Gene3D: G3DSA:3.80.10.10
556-786 G3DSA:3.80.10.10

QLKLLRVLDLGGVRFAWEEGKRSLPEVIGDLIHLRYLGIADTFLSNFPSFISNLRFLQTLDSSGNESKVDLRHITSLRHVIGNFAGGLLLGESVNLQTLRAISADSWSKLKHELLINLRDLEIYVGFATVERGVPVRWASLTKLRNLRVLRLHSDDIPLSLESEEAVRSMDVISPSLESVTFFGIYLKEDPMPFFQKMPRLEDLILENCYYSGEKISVSEQGFGRLRKLQL


List of References

Laura E Rose, Peter D Bittner-Eddy, Charles H Langley, Eric B Holub, Richard W Michelmore, Jim L Beynon
The maintenance of extreme amino acid diversity at the disease resistance gene, RPP13, in Arabidopsis thaliana.
Genetics: 2004, 166(3);1517-27
PubMed:15082565 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox