PRGDB00050644 (unnamed protein product [Arabidopsis thaliana].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Arabidopsis thaliana].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3046850 (AB012242)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K24G6.

DNA Sequence

ATGTCTTCCTCTTCTTCCTCTTCCAGTCAGAAATTCTACGTTTTTCTGAGCTTCCAAGGCCTGGACACCCGTAGAACCTTTGTCAGCCATCTCCGCCGTTCATTGGACAGAAAAGGCATTAAGACTTTTGAAGATGAAAATGAGTCTCTGAGAGGTGAATTAGATTCTTCTGCGGTCTATCAGACAATTGGAGAGTCAAAAGTGGCCGTTGTCTTGATATCGGTGAACTATGCCTCTTCACCTTTGTGCCTGGATAGTCTCCTTAAGATTTTGAAGTTTCACCAGTCAGGTTCACTCGTTTTGATACCAATCTTCTATGAAGTTGATCCTATGGATGTAAGAAAACAAATTGGGAAACTGTACGAAGCATTCTCATTGCATGAGAGAGAAAACCCTGAAAAGGTTCAAACATGGAGGCAAGCACTGTCCCAACTGGTCAGCATTCCGGGCGGCCAGTACTCAGAGATTTGGGATGGTGATGCAGAGCTGATCCATCAAATTACCGTTGACATATGGAATATATTTGTCGCTTCCAAGTCAAGTGATTTGTGTGGTCTTGTGGGGATGGATCGCCACATGAAAGCCATGTATAGATTGTTAGATTTAGGATTGAAAGATGAAGTTCGTCATATCAAAATTTGGGGTAGCCGAGACATCGGCAAGACTGAGTTTGCAAAATATCTGTATGAAGAGATTTTGCACAACTTTGATACCCATGTCATGTTAAAAGCTCCACAAAGAATTTCGCGTTTTGAGGAGGTTCGTTTGGCAGAATATGTGTGTCTTCGACTTGAGAAAGCAAGAACTTTGTCAAAAACATCGAAGGACACTGCATCAAGGTTTCTCCTCGTACTGGATAATGTGAATGAATCATTTGACCCAATAAGAAAACTTGCAAGGGTGATTAGTTCTTTTGGTCCAGGGAGCAGGATCATTACAACCACCCGAAACTTGCAGTTCAGTTCGACTTCCCCTTTACCGTTTCAATATGAAGTTTTAGGGCTGGAGTTCTCTGAAGCTCTTCAGCTCTTCTGTCTCCATGCTTTCGAGCAGACTCATCCTTTTCTTGGTTTTGAAGACCTTTCATGTCGTGCAGTGAAACTCGCAGGTGGTTTTCCTTTATCCTTAAAAAGATTAGGCTCCAGATTTTCTGGTAGAAAGAAGGATGAATGGGAAGTGATCTTGTTTGGATACGAAAGATCAACTGTTAACGGTGTTATAAATCCCGAAAAAAATAGCCTGGATGGGCTATACGAATACAGCTCTATCATGGAAACTTTTTCAAGTCAACCGATTTCAAGCACAACAAGAAGTTTTGAAGACCTTGTGGGGATGAATCATCGTATGCAAGCTTTGTCGGCATTGTTAGAGCTAGAATCCGACAAAGAAGTTCGTGTAGTTGGAATTTGGGGTACAGGAGGCATTGGTAAAACAACTCTATCAAGATATGCTTACGAGAGAATCTCGCAGCAATTCCACACCCATGCTTTTCTAGAAAATGCTCAAGAGAGCAGTTCATCCTGTCTAGAAGAACGGTTTCTATCCAAAGCTATCCAAAGAGAAGCGCTTGCAGTAAGGAACTCTAAAGACTGTCCAGAAATAATGAAATCATTGATTCAACACCGAAAAGTTCTGCTTATAGTTGATGATGTGGATAACGTCAAGACGTTAGAGGAAGTCTTCAAGATCACCAGTTGGTTGGTCCCTGGAAGTAGAGTTATTGTGACTGCACGAGATGAGAGTTTTCTTCTGGCCAGTGGAGTGAAATATATTTTTGAAGTTAAGGGCCTGAGATTTGACCAAGCTCTTCAACTTTTCTATCAATTCGCTTTCAAGCAGAAATCACCTCCGGTTCGGTTCAGACAGCTATCAGTTCGGGCAATCAAGCTTGTTGGATTTCTCCCCTTAGCCCTTAAAGTGACCGGCTCAATGTTATATCGTAAAAAAGAATCCTACTGGGAAACTATATTGCAGTGTTTTGAAGAAAAGCAGAATAAAGGTACAATTTGA


Protein sequences

Name Description Sequence
unnamed protein product [Arabidopsis thaliana]. unnamed protein product [Arabidopsis thaliana].

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPGGQYSEIWDGDAELIHQITVDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETILQCFEEKQNKGTI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MSSSSSSSSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSIPG

Gene3D: G3DSA:3.40.50.10140
8-145 G3DSA:3.40.50.10140

SSQKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQL

ProfileScan: PS50104
IPR000157
10-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

QKFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMSmart: SM00255
IPR000157
11-148 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFYVFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALSQLVSI

HMMPfam: PF01582
IPR000157
14-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLISVNYASSPLCLDSLLKILKFHQSGSLVLIPIFYEVDPMDVRKQIGKLYEAFSLHERENPEKVQTWRQALS

superfamily: SSF52540
169-406 SSF52540

VDIWNIFVASKSSDLCGLVGMDRHMKAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGV

HMMPfam: PF00931
IPR002182
194-396 NB-ARC,NBS
NB-ARC

KAMYRLLDLGLKDEVRHIKIWGSRDIGKTEFAKYLYEEILHNFDTHVMLKAPQRISRFEEVRLAEYVCLRLEKARTLSKTSKDTASRFLLVLDNVNESFDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILF

HMMPanther: PTHR11017:SF20
292-657 PTHR11017:SF20,SUBFAMILY NOT NAMED

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETIL

HMMPanther: PTHR11017
292-657 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FDPIRKLARVISSFGPGSRIITTTRNLQFSSTSPLPFQYEVLGLEFSEALQLFCLHAFEQTHPFLGFEDLSCRAVKLAGGFPLSLKRLGSRFSGRKKDEWEVILFGYERSTVNGVINPEKNSLDGLYEYSSIMETFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETIL

superfamily: SSF52540
424-668 SSF52540

METFSSQPISSTTRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETILQCFEEKQNKGT

Gene3D: G3DSA:3.40.50.300
436-578 G3DSA:3.40.50.300

TRSFEDLVGMNHRMQALSALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTAR

HMMPfam: PF00931
IPR002182
454-665 NB-ARC,NBS
NB-ARC

ALLELESDKEVRVVGIWGTGGIGKTTLSRYAYERISQQFHTHAFLENAQESSSSCLEERFLSKAIQREALAVRNSKDCPEIMKSLIQHRKVLLIVDDVDNVKTLEEVFKITSWLVPGSRVIVTARDESFLLASGVKYIFEVKGLRFDQALQLFYQFAFKQKSPPVRFRQLSVRAIKLVGFLPLALKVTGSMLYRKKESYWETILQCFEEKQN

FPrintScan: PR00364
IPR000767
466-481 DISEASERSIST
Disease resistance protein

VVGIWGTGGIGKTTLS

FPrintScan: PR00364
IPR000767
538-552 DISEASERSIST
Disease resistance protein

LIQHRKVLLIVDDVD

FPrintScan: PR00364
IPR000767
631-645 DISEASERSIST
Disease resistance protein

VGFLPLALKVTGSML


List of References

H Kotani, Y Nakamura, S Sato, E Asamizu, T Kaneko, N Miyajima, S Tabata
Structural analysis of Arabidopsis thaliana chromosome 5. VI. Sequence features of the regions of 1,367,185 bp covered by 19 physically assigned P1 and TAC clones.
DNA Res.: 1998, 5(3);203-16
PubMed:9734815 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox