PRGDB00050648 (unnamed protein product [Arabidopsis thaliana].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Arabidopsis thaliana].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6573284 (AB008018)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana mRNA expressed from chromosome 1, complete cds.

DNA Sequence

ATGGCTGGAGAACTTGTGTCGTTTGGAATAAAAAAGCTTTGGGACCTACTGAGTCAAGAATGCGAGCAATTTCAGGGAGTTGAAGATCAAGTTACTGGACTAAAACGTGATCTAAACTTGTTAAGCTCTTTTCTAAAAGATGCAGATGCAAAGAAACATACAACTGCGGTGGTGAGAAATGTTGTCGAAGAAATAAAGGAAATTGTTTACGACGCAGAAGATATAATTGAAACATATCTTCTTAAAGAAAAACTTTGGAAAACAAGTGGAATCAAGATGCGTATCAGAAGACATGCTTGCATTATTTCAGATCGTAGGAGAAATGCATTAGATGTTGGAGGCATACGTACGAGGATCTCGGATGTGATCCGAGATATGCAGAGTTTTGGAGTGCAACAAGCTATCGTTGATGGTGGTTATATGCAACCTCAAGGTGATAGACAAAGGGAGATGCGACAAACGTTTTCTAAGGACTACGAAAGCGATTTTGTGGGGTTGGAGGTAAATGTTAAGAAACTGGTTGGATATTTGGTGGACGAAGAAAACGTTCAAGTGGTTTCCATAACCGGGATGGGTGGTCTAGGTAAAACCACACTTGCTAGACAGGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATAGACTCGCATGGGTGTGTGTCTCACAAGAGTTTACTCGGAAGAATGTATGGCAAATGATCTTGCAGAATCTAACCTCTAGAGAAAAGAAAGATGAAATCTTGCAAATGGAAGAAGCTGAACTCCATGATAAACTCTTTCAGCTATTGGAGACATCTAAATCATTAATTGTCTTTGATGACATATGGAAAGACGAAGATTGGGACCTAATAAAGCCAATATTTCCACCCAATAAAGGTTGGAAGGTGCTTCTTACTTCTCAAAATGAGAGTGTCGCGGTACGTGGGGATATAAAATATCTCAACTTTAAACCAGAATGCCTAGCCATTGAGGATAGTTGGACACTTTTCCAAAGAATAGCATTTCCAAAGAAAGATGCATCTGAATCTAAGGTTGACGAGGAAATGGAAGATATGGGTAAGCAAATGTTAAAACATTGTGGAGGGCTACCATTAGCCATCAAAGTGTTAGGAGGTTTGTTAGCTGCAAAGTACACAATGCATGATTGGGAAAGACTATCCGTAAATATCGGATCTGATATCGTGGGAAGAACCAGCAGTAACAACAGTTCAATATACCATGTATTGTCTATGAGCTTTGAGGAGTTGCCTAGTTATTTGAAACATTGTTTCCTCTACCTGGCCCATTTTCCAGAAGATCATAAGATTAACGTGGAGAAATTGTCTTATTGTTGGGCTGCAGAAGGAATATCCACCGCCGAAGATTATCACAATGGAGAGACCATTCAAGATGTTGGACAGAGCTACCTAGAGGAGTTAGTGAGGAGGAATATGATAATTTGGGAAAGAGATGCTACTGCTTCGAGATTTGGAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTTAAAGCCAAGGAAGAAAACTTCCTACAAATTGCTGTAAAAAGTGTAGGTGTAACCAGCTCCTCGACCGGAAACTCTCAATCTCCTTGTAGATCTCGCAGGCTTGTCTACCAATGTCCAACTACATTACATGTTGAGAGAGATATAAACAATCCAAAACTTAGATCTCTCGTGGTTCTCTGGCATGATTTATGGGTAGAAAATTGGAAGCTATTAGGTACAAGCTTTACAAGGTTAAAACTTCTGAAAGTGTTAGATCTCTTCAAAGTCGAACGCGGCCGCGAATTCGCGGCCGCGTTCGACTTTGGAATCTCAAAATTAGTCATTTGA


Protein sequences

Name Description Sequence
unnamed protein product [Arabidopsis thaliana]. unnamed protein product [Arabidopsis thaliana].

MAGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLKVLDLFKVERGREFAAAFDFGISKLVI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
11-591 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLKVLDL

HMMPanther: PTHR11017:SF125
11-591 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

KKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLKVLDL

superfamily: SSF52540
146-398 P-loop containing nucleoside triphosphate hydrolases

DRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRT

HMMPfam: PF00931
IPR002182
168-455 NB-ARC,NBS
NB-ARC

VNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAED

Gene3D: G3DSA:3.40.50.300
180-304 no description

EENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNES

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLETSKSLIVFDDIW

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAIKVLGGLL

Seg: seg
519-532 seg

SVGVTSSSTGNSQS

FPrintScan: PR00364
IPR000767
581-597 DISEASERSIST
Disease resistance protein

TRLKLLKVLDLFKVERG

Seg: seg
583-594 seg

LKLLKVLDLFKV


List of References

A Kato, M Suzuki, A Kuwahara, H Ooe, K Higano-Inaba, Y Komeda
Isolation and analysis of cDNA within a 300 kb Arabidopsis thaliana genomic region located around the 100 map unit of chromosome 1.
Gene: 1999, 239(2);309-16
PubMed:10548732 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox