PRGDB00050649 (RXW24L)

From PRG Wiki
Jump to: navigation, search
RXW24L
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6566296 (AB008019)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RXW24L mRNA, partial cds.

DNA Sequence

CTCGTTCAAGCCAAGTTTAAAGGAGGGAAGTTACCTTCTGACATTGGAAAGCTCATCCACTTAAGATACTTGAGCTTAAAAGATGCCAAGGTATCTCATCTACCTTCTTCTCTAAGAAATCTAGTCCTGCTAATCTATTTAGATATACGCACAGATTTCACGGATATATTCGTGCCCAATGTCTTCATGGGGATGAGAGAATTGAGATATCTTGAACTACCCAGATTTATGCATGAGAAGACAAAGTTGGAGTTGAGTAATCTAGAAAAATTGGAGGCCTTAGAGAATTTCTCAACAAAGAGTAGCAGCTTGGAGGATCTCCGTGGTATGGTCAGGTTGAGGACTCTTGTGATCATTTTAAGTGAGGGGACTAGTCTACAAACTCTATCTGCATCAGTATGTGGACTGAGACACTTGGAAAATTTTAAAATAATGGAAAACGCTGGCGTTAACAGGATGGGAGAAGAGAGAATGGTATTGGATTTCACTTATCTCAAAAAGCTCACCTTGAGTATAGAGATGCCAAGGCTTCCTAAAATACAACACCTTCCTTCTCACCTTACGGTCTTAGATCTATCTTACTGTTGTTTGGAGGAAGATCCAATGCCGATTCTAGAGAAATTACTCGAGTTAAAAGATTTAAGTTTAGATTATCTATCTTTCTCCGGGAGGAAAATGGTTTGCTCGGCTGGTGGGTTTCCTCAATTGCGTAAGCTAGCTTTGGATGAACAAGAGGAGTGGGAAGAGTGGATAGTAGAAGAAGGCTCCATGTCACGGCTTCATACTCTAAGTATTTGGAGTTCAACATTAAAGGAGCTTCCTGATGGGCTGCGATTCATATATTCTTTAAAGAATCTGATCATGGGAAAGAGCTGGATGGAGAGATTATCGGAACGAGGAGAAGAATTTTACAAAGTTCAAAACATTCCTTTTATTAAATTCAGTTCTTAA



Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-288 L domain-like,LRR

LVQAKFKGGKLPSDIGKLIHLRYLSLKDAKVSHLPSSLRNLVLLIYLDIRTDFTDIFVPNVFMGMRELRYLELPRFMHEKTKLELSNLEKLEALENFSTKSSSLEDLRGMVRLRTLVIILSEGTSLQTLSASVCGLRHLENFKIMENAGVNRMGEERMVLDFTYLKKLTLSIEMPRLPKIQHLPSHLTVLDLSYCCLEEDPMPILEKLLELKDLSLDYLSFSGRKMVCSAGGFPQLRKLALDEQEEWEEWIVEEGSMSRLHTLSIWSSTLKELPDGLRFIYSLKNLIM

HMMPanther: PTHR23155
11-314 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LPSDIGKLIHLRYLSLKDAKVSHLPSSLRNLVLLIYLDIRTDFTDIFVPNVFMGMRELRYLELPRFMHEKTKLELSNLEKLEALENFSTKSSSLEDLRGMVRLRTLVIILSEGTSLQTLSASVCGLRHLENFKIMENAGVNRMGEERMVLDFTYLKKLTLSIEMPRLPKIQHLPSHLTVLDLSYCCLEEDPMPILEKLLELKDLSLDYLSFSGRKMVCSAGGFPQLRKLALDEQEEWEEWIVEEGSMSRLHTLSIWSSTLKELPDGLRFIYSLKNLIMGKSWMERLSERGEEFYKVQNIPFIKF

HMMPanther: PTHR23155:SF233
11-314 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LPSDIGKLIHLRYLSLKDAKVSHLPSSLRNLVLLIYLDIRTDFTDIFVPNVFMGMRELRYLELPRFMHEKTKLELSNLEKLEALENFSTKSSSLEDLRGMVRLRTLVIILSEGTSLQTLSASVCGLRHLENFKIMENAGVNRMGEERMVLDFTYLKKLTLSIEMPRLPKIQHLPSHLTVLDLSYCCLEEDPMPILEKLLELKDLSLDYLSFSGRKMVCSAGGFPQLRKLALDEQEEWEEWIVEEGSMSRLHTLSIWSSTLKELPDGLRFIYSLKNLIMGKSWMERLSERGEEFYKVQNIPFIKF

Gene3D: G3DSA:3.80.10.10
164-288 no description

YLKKLTLSIEMPRLPKIQHLPSHLTVLDLSYCCLEEDPMPILEKLLELKDLSLDYLSFSGRKMVCSAGGFPQLRKLALDEQEEWEEWIVEEGSMSRLHTLSIWSSTLKELPDGLRFIYSLKNLIM

Seg: seg
205-220 seg

LEKLLELKDLSLDYLS

Seg: seg
243-254 seg

EQEEWEEWIVEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox