PRGDB00050655 (T18I24.18)

From PRG Wiki
Jump to: navigation, search
T18I24.18
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12321377 (AC079131)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T18I24 genomic sequence, complete sequence.

DNA Sequence

ATGTTGATATTCACTATACCGCAGTTTTTCTTCGCAGCATGGGTCATGGTTGTATCACTACAAATGCAAGGGTATATAAGTTGCATCGAGAAGGAGAGGAAGGGATTGTTGGAGCTCAAGGCTTATGTGAACAAGGAATATTCATATGATTGGTCTAATGACACGAAGAGTGATTGTTGCCGATGGGAAAGAGTGGAGTGTGATCGTACAAGTGGACGTGTGATCGGCCTCTTCTTGAATCAAACATTCAGTGATCCAATCCTGATAAATCTTTCCTTGTTTCACCCCTTTGAAGAATTGCGGACTTTAAACTTATATGATTTCGGATGCACAGGCTGGTTCGATGATATCCATGGGTATAAAAGCCTTGGGAAATTAAAAAAACTTGAGATCCTCGATATGGGTAACAACGAAGTCAATAACAGTGTCTTACCCTTTCTAAATGCCGCTTCTTCGCTTAGAACTTTAATTCTTCATGGAAACAATATGGAAGGTACTTTTCCAATGAAAGAGCTAAAAGACTTGAGTAATCTAGAACTGTTGGATCTAAGTGGGAACTTGCTCAATGGCCCTGTGCCAGGCTTGGCGGTTTTGCATAAGCTTCATGCTTTGGATTTAAGTGACAACACATTTTCTGGATCATTAGGAAGAGAAGGACTTTGTCAATTAAAAAATTTGCAAGAGCTTGATTTGAGTCAAAACGAATTTACCGGTCCATTTCCTCAGTGTTTTAGTAGCTTAACCCAACTCCAAGTTCTTGATATGTCTTCAAACCAATTCAATGGGACGCTTCCATCTGTTATCAGCAATCTTGATTCTCTTGAGTATTTATCTCTCTCAGATAATAAGTTTGAGGGTTTCTTCTCTTTCGATTTGATCGCCAACCTTTCTAAGCTCAAGGTGTTCAAACTTTCATCAAAATCTAGTTTGCTGCATATAGAGTCAGAAATCTCCCTACAACTGAAGTTTCGGTTGAGTGTTATTGATTTAAAATATTGCAACTTGGAAGCAGTTCCTAGCTTTCTTCAACAGCAGAAAGATTTGCGTCTAATTAATCTCTCCAACAACAAGTTGACCGGAATATCTCCATCTTGGTTTTTGGAGAACTATCCAAAACTTCGAGTTTTGCTTTTATGGAACAACTCATTCACTATCTTTCATCTTCCAAGACTACTTGTTCATAGTTTGCATGTTTTGGATCTATCAGTCAACAAGTTTGATGAATGGCTTCCCAACAATATCGGACATGTGCTTCCCAATATAAGTCACTTGAATCTTTCGAATAATGGGTTTCAAGGGAATTTGCCTTCTTCGTTTAGTGAGATGAAAAAGATCTTCTTCTTGGACTTATCACATAATAACTTGTCAGGCAGTCTACCAAAGAAATTTTGCATTGGTTGTTCTTCATTAAGTATTTTGAAGCTTTCATACAACAGATTTAGTGGCAAGATTTTCCCACAACCAATGAAGTTGGAGTCGTTGAGGGTGTTGATTGCGGATAACAATCAATTTACCGAGATCACGGATGTGTTGATTCATTCAAAGGGTTTAGTATTTCTCGAACTGTCGAATAATTCTCTACAAGGTGTCATCCCAAGTTGGTTTGGAGGCTTTTATTTCTTGTATCTTTCGGTTTCGGATAATCTCCTAAATGGTACAATACCAAGCACCCTCTTTAACGTATCTTTCCAGCTTTTGGACCTCTCACGAAACAAGTTTTCCGGTAACTTGCCTTCACACTTCAGTTTTCGGCATATGGGTTTGTTGTACCTCCATGATAATGAATTCAGTGGGCCAGTTCCAAGTACATTGCTAGAAAATGTTATGTTACTCGATCTACGAAATAACAAGTTATCCGGCACTATCCCACGATTTGTCAGCAACCGATATTTTCTTTATCTTTTGTTGAGGGGTAACGCATTAACGGGTCATATCCCAACTAGTCTTTGTGAGCTAAAGAGCATCAGGGTTTTGGATCTTGCTAATAACAGATTGAATGGTTCGATACCTCCATGCCTTAACAATGTATCCTTTGGGAGGAGCTTAGACTATGAGATAGATCCTGACTTTGGATCATCATATGGCATGGTTAGAGCAGATCAAGAATTAGAGGAGTCGTATTCTAGGTCCTTGGTTTTACCACTTGAGTTTGAGCTAGATTACTCAGGCTATTTGGACTTCACAGTGGAATTTGCATCAAAGAGAAGATATGATTCTTACATGGGAGAAAGTTTCAAGTTCATGTTTGGACTGGATTTTTCAAGTAATGAACTTATTGGTGAAATCCCGAGAGAGCTAGGAGATTTTCAAAGAATACGTGCTTTGAATTTGTCTCACAATTCCTTGTCAGGTTTAGTACCTGAAAGCTTCTCCAATCTAACAGATATAGAGAGCATTGATCTTTCGTTTAACGTGTTGCATGGACCAATACCTCATGACCTAACCAAGTTAGACTATATAGTTGTGTTTAATGTTTCATACAACAACCTCTCGGGCTTAATTCCAAGTCAAGGAAAGTTTTTAAGCTTGGATGTAACCAATTACATTGGTAATCCTTTTCTATGTGGGACAACTATAAATAAAAGTTGCGATGATAACACTAGTGGTTTCAAGGAAATAGATTCTCATAGTGGAGATGACGAAACAGCAATCGATATGGAGACATTTTATTGGAGCCTCTTCGCCACATACGCATTTGTAATGGTAATGGACCTAATGGTGCTGGTTATGATGATAATGATGATGGTATCATCGCTGGATGCGCATGGGCATATAAGTTGCATCGAAAGCGAAAGGAAAGGACTGCTAGAGCTCAAGGCATATCTCAACATATCCGAGTACCCGTATGATTGGCCTAATGACACGAACAACAGCGACTGTTGCAAATGGGAAAGAGTCAAGTGTGATCTTACCAGCGGGCGTTATAAAAGCTTTGAGAGATTGAAAAATCTTGAGATCCTTGATATTAGTGAAAACGGCGTCAATAATACTGTCTTACCGTTTATAAACACGGCTTCTTCGCTTAAAACTTTAATTCTTCATGGAAACAATATGGAAGGTACTTTTCCAATGAAAGAACTTATAAACTTGAGAAATCTAGAACTGCTGGATCTAAGTAAGAACCAGTTTGTTGGGCCAGTGCCAGACTTGGCAAATTTTCATAACCTTCAAGGTTTGGACATGAGTGATAACAAATTTTCTGGGTCAAACAAAGGACTTTGTCAACTGAAAAATTTACGAGAGCTTGATCTAAGTCAAAACAAATTTACAGGTCAATTTCCTCAATGTTTTGATAGCTTGACCCAACTCCAAGTTCTTGATATCTCTTCAAACAACTTCAATGGTACAGTTCCATCTCTTATCAGAAATCTTGATTCTGTTGAGTATTTAGCTCTCTCGGATAATGAGTTTAAGGGTTTCTTTTCTTTGGAATTAATCGCCAACCTCTCGAAGCTCAAGGTATTCAAACTTTCATCAAGATCTAATTTGTTGCGTCTAAAAAAGTTGTCCTCCTTACAGCCAAAGTTTCAGCTAAGTGTCATCGAGCTACAAAATTGCAACTTGGAAAATGTTCCAAGCTTTATTCAACACCAGAAGGATTTGCATGTGATTAACCTCTCCAACAACAAGTTAACTGGAGTATTTCCCTATTGGCTTTTGGAGAAATATCCAAATCTTCGGGTTTTGCTTTTGCAGAACAACTCTTTAACCATGCTTGAGTTGCCAAGACTACTTAATCATACTTTGCAGATTTTGGATTTATCAGCCAATAATTTTGATCAACGGCTTCCAGAGAACATTGGAAAGGTTCTTCCAAATATAAGGCACTTGAATCTTTCCAACAATGGGTTTCAATGGATACTACCATCGTCATTCGGTGAGATGAAAGATATTAAGTTCTTGGACTTATCTCATAATAATTTCTCTGGAAGTCTACCAATGAAGTTTCTTATTGGTTGTTCTTCATTGCACACTTTGAAGCTTTCATACAACAAATTCTTTGGTCAAATTTTCCCAAAACAGACAAACTTTGGGAGTTTGGTCGTGTTGATTGCGAATAACAATCTATTTACTGGGATCGCAGATGGGTTGCGTAACGTGCAATCTCTTGGAGTGCTCGACTTGTCGAATAACTATCTACAAGGTGTCATTCCAAGTTGGTTCGGCGGCTTTTTCTTTGCCTATCTTTTTCTCTCCAACAATCTTTTAGAAGGTACCTTGCCAAGCACGCTTTTTAGTAAACCTACATTTAAAATTTTGGACCTCTCTGGAAACAAGTTCTCGGGGAACTTACCTTCGCACTTCACTGGTATGGATATGAGTCTATTGTATCTCAACGACAATGAGTTCAGTGGGACAATTCCAAGTACATTGATAAAAGATGTTTTGGTACTTGATCTGCGAAATAACAAATTGTCCGGGACTATTCCGCATTTTGTCAAGAACGAGTTTATCCTCTCTCTTTTGTTGAGGGGTAACACATTAACGGGTCATATTCCTACTGATCTATGTGGTCTAAGAAGCATTAGGATCTTGGATCTTGCCAACAACAGATTGAAGGGATCTATACCAACATGTCTCAACAATGTATCATTTGGGAGGAGGTTAAACTATGAGGTTAATGGCGACAAATTACCATTTGAAATCAATGACGATGAAGAATTCGCTGTGTATTCTAGGTTATTGGTTTTACCACGTCAGTATTCTCCAGACTACACCGGCGTTTTGATGTTCAATGTTGAATTTGCATCAAAGAGTAGGTATGATTCTTACACTCAAGAAAGTTTCAACTTTATGTTTGGACTTGATCTGTCAAGTAATGAACTCAGTGGTGACATACCAAAGGAGCTTGGAGATCTTCAGAGAATACGTGCTTTAAATCTGTCTCATAATTCCTTGTCAGGTTTGATACCTCAAAGCTTCTCCAATCTAACGGATATTGAGAGCATTGATCTTTCGTTTAACTTGTTGCGGGGACCGATACCTCAAGATCTATCCAAGTTAGACTATATGGTTGTATTCAATGTGTCCTACAACAACCTCTCAGGCTCCATTCCAAGTCACGGAAAATTTTCTACGTTGGATGAAACCAACTTCATTGGTAATCTTCTTCTCTGTGGTTCAGCTATAAACAGAAGTTGTGATGATAACAGCACTACCGAGTTCCTTGAATCTGATGATCAAAGCGGGGATGAGGAAACAACAATCGATATGGAAATTTTCTACTGGAGTCTTGCTGCTACCTATGGTGTAACATGGATCACATTTATTGTGTTTCTTTGCTTTGATTCACCTTGGCGCCGAGTATGGTTTCACTTTGTTGATGCTTTTATCAGTCTTTTCAAGTGTGTTTGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Arabidopsis thaliana].

MLIFTIPQFFFAAWVMVVSLQMQGYISCIEKERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGLAVLHKLHALDLSDNTFSGSLGREGLCQLKNLQELDLSQNEFTGPFPQCFSSLTQLQVLDMSSNQFNGTLPSVISNLDSLEYLSLSDNKFEGFFSFDLIANLSKLKVFKLSSKSSLLHIESEISLQLKFRLSVIDLKYCNLEAVPSFLQQQKDLRLINLSNNKLTGISPSWFLENYPKLRVLLLWNNSFTIFHLPRLLVHSLHVLDLSVNKFDEWLPNNIGHVLPNISHLNLSNNGFQGNLPSSFSEMKKIFFLDLSHNNLSGSLPKKFCIGCSSLSILKLSYNRFSGKIFPQPMKLESLRVLIADNNQFTEITDVLIHSKGLVFLELSNNSLQGVIPSWFGGFYFLYLSVSDNLLNGTIPSTLFNVSFQLLDLSRNKFSGNLPSHFSFRHMGLLYLHDNEFSGPVPSTLLENVMLLDLRNNKLSGTIPRFVSNRYFLYLLLRGNALTGHIPTSLCELKSIRVLDLANNRLNGSIPPCLNNVSFGRSLDYEIDPDFGSSYGMVRADQELEESYSRSLVLPLEFELDYSGYLDFTVEFASKRRYDSYMGESFKFMFGLDFSSNELIGEIPRELGDFQRIRALNLSHNSLSGLVPESFSNLTDIESIDLSFNVLHGPIPHDLTKLDYIVVFNVSYNNLSGLIPSQGKFLSLDVTNYIGNPFLCGTTINKSCDDNTSGFKEIDSHSGDDETAIDMETFYWSLFATYAFVMVMDLMVLVMMIMMMVSSLDAHGHISCIESERKGLLELKAYLNISEYPYDWPNDTNNSDCCKWERVKCDLTSGRYKSFERLKNLEILDISENGVNNTVLPFINTASSLKTLILHGNNMEGTFPMKELINLRNLELLDLSKNQFVGPVPDLANFHNLQGLDMSDNKFSGSNKGLCQLKNLRELDLSQNKFTGQFPQCFDSLTQLQVLDISSNNFNGTVPSLIRNLDSVEYLALSDNEFKGFFSLELIANLSKLKVFKLSSRSNLLRLKKLSSLQPKFQLSVIELQNCNLENVPSFIQHQKDLHVINLSNNKLTGVFPYWLLEKYPNLRVLLLQNNSLTMLELPRLLNHTLQILDLSANNFDQRLPENIGKVLPNIRHLNLSNNGFQWILPSSFGEMKDIKFLDLSHNNFSGSLPMKFLIGCSSLHTLKLSYNKFFGQIFPKQTNFGSLVVLIANNNLFTGIADGLRNVQSLGVLDLSNNYLQGVIPSWFGGFFFAYLFLSNNLLEGTLPSTLFSKPTFKILDLSGNKFSGNLPSHFTGMDMSLLYLNDNEFSGTIPSTLIKDVLVLDLRNNKLSGTIPHFVKNEFILSLLLRGNTLTGHIPTDLCGLRSIRILDLANNRLKGSIPTCLNNVSFGRRLNYEVNGDKLPFEINDDEEFAVYSRLLVLPRQYSPDYTGVLMFNVEFASKSRYDSYTQESFNFMFGLDLSSNELSGDIPKELGDLQRIRALNLSHNSLSGLIPQSFSNLTDIESIDLSFNLLRGPIPQDLSKLDYMVVFNVSYNNLSGSIPSHGKFSTLDETNFIGNLLLCGSAINRSCDDNSTTEFLESDDQSGDEETTIDMEIFYWSLAATYGVTWITFIVFLCFDSPWRRVWFHFVDAFISLFKCV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1770 PTHR24420,FAMILY NOT NAMED

MLIFTIPQFFFAAWVMVVSLQMQGYISCIEKERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGLAVLHKLHALDLSDNTFSGSLGREGLCQLKNLQELDLSQNEFTGPFPQCFSSLTQLQVLDMSSNQFNGTLPSVISNLDSLEYLSLSDNKFEGFFSFDLIANLSKLKVFKLSSKSSLLHIESEISLQLKFRLSVIDLKYCNLEAVPSFLQQQKDLRLINLSNNKLTGISPSWFLENYPKLRVLLLWNNSFTIFHLPRLLVHSLHVLDLSVNKFDEWLPNNIGHVLPNISHLNLSNNGFQGNLPSSFSEMKKIFFLDLSHNNLSGSLPKKFCIGCSSLSILKLSYNRFSGKIFPQPMKLESLRVLIADNNQFTEITDVLIHSKGLVFLELSNNSLQGVIPSWFGGFYFLYLSVSDNLLNGTIPSTLFNVSFQLLDLSRNKFSGNLPSHFSFRHMGLLYLHDNEFSGPVPSTLLENVMLLDLRNNKLSGTIPRFVSNRYFLYLLLRGNALTGHIPTSLCELKSIRVLDLANNRLNGSIPPCLNNVSFGRSLDYEIDPDFGSSYGMVRADQELEESYSRSLVLPLEFELDYSGYLDFTVEFASKRRYDSYMGESFKFMFGLDFSSNELIGEIPRELGDFQRIRALNLSHNSLSGLVPESFSNLTDIESIDLSFNVLHGPIPHDLTKLDYIVVFNVSYNNLSGLIPSQGKFLSLDVTNYIGNPFLCGTTINKSCDDNTSGFKEIDSHSGDDETAIDMETFYWSLFATYAFVMVMDLMVLVMMIMMMVSSLDAHGHISCIESERKGLLELKAYLNISEYPYDWPNDTNNSDCCKWERVKCDLTSGRYKSFERLKNLEILDISENGVNNTVLPFINTASSLKTLILHGNNMEGTFPMKELINLRNLELLDLSKNQFVGPVPDLANFHNLQGLDMSDNKFSGSNKGLCQLKNLRELDLSQNKFTGQFPQCFDSLTQLQVLDISSNNFNGTVPSLIRNLDSVEYLALSDNEFKGFFSLELIANLSKLKVFKLSSRSNLLRLKKLSSLQPKFQLSVIELQNCNLENVPSFIQHQKDLHVINLSNNKLTGVFPYWLLEKYPNLRVLLLQNNSLTMLELPRLLNHTLQILDLSANNFDQRLPENIGKVLPNIRHLNLSNNGFQWILPSSFGEMKDIKFLDLSHNNFSGSLPMKFLIGCSSLHTLKLSYNKFFGQIFPKQTNFGSLVVLIANNNLFTGIADGLRNVQSLGVLDLSNNYLQGVIPSWFGGFFFAYLFLSNNLLEGTLPSTLFSKPTFKILDLSGNKFSGNLPSHFTGMDMSLLYLNDNEFSGTIPSTLIKDVLVLDLRNNKLSGTIPHFVKNEFILSLLLRGNTLTGHIPTDLCGLRSIRILDLANNRLKGSIPTCLNNVSFGRRLNYEVNGDKLPFEINDDEEFAVYSRLLVLPRQYSPDYTGVLMFNVEFASKSRYDSYTQESFNFMFGLDLSSNELSGDIPKELGDLQRIRALNLSHNSLSGLIPQSFSNLTDIESIDLSFNLLRGPIPQDLSKLDYMVVFNVSYNNLSGSIPSHGKFSTLDETNFIGNLLLCGSAINRSCDDNSTTEFLESDDQSGDEETTIDMEIFYWSLAATYGVTWITFIVFLCFDSPWRRVW

HMMPanther: PTHR24420:SF473
1-1770 PTHR24420:SF473,SUBFAMILY NOT NAMED

MLIFTIPQFFFAAWVMVVSLQMQGYISCIEKERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGLAVLHKLHALDLSDNTFSGSLGREGLCQLKNLQELDLSQNEFTGPFPQCFSSLTQLQVLDMSSNQFNGTLPSVISNLDSLEYLSLSDNKFEGFFSFDLIANLSKLKVFKLSSKSSLLHIESEISLQLKFRLSVIDLKYCNLEAVPSFLQQQKDLRLINLSNNKLTGISPSWFLENYPKLRVLLLWNNSFTIFHLPRLLVHSLHVLDLSVNKFDEWLPNNIGHVLPNISHLNLSNNGFQGNLPSSFSEMKKIFFLDLSHNNLSGSLPKKFCIGCSSLSILKLSYNRFSGKIFPQPMKLESLRVLIADNNQFTEITDVLIHSKGLVFLELSNNSLQGVIPSWFGGFYFLYLSVSDNLLNGTIPSTLFNVSFQLLDLSRNKFSGNLPSHFSFRHMGLLYLHDNEFSGPVPSTLLENVMLLDLRNNKLSGTIPRFVSNRYFLYLLLRGNALTGHIPTSLCELKSIRVLDLANNRLNGSIPPCLNNVSFGRSLDYEIDPDFGSSYGMVRADQELEESYSRSLVLPLEFELDYSGYLDFTVEFASKRRYDSYMGESFKFMFGLDFSSNELIGEIPRELGDFQRIRALNLSHNSLSGLVPESFSNLTDIESIDLSFNVLHGPIPHDLTKLDYIVVFNVSYNNLSGLIPSQGKFLSLDVTNYIGNPFLCGTTINKSCDDNTSGFKEIDSHSGDDETAIDMETFYWSLFATYAFVMVMDLMVLVMMIMMMVSSLDAHGHISCIESERKGLLELKAYLNISEYPYDWPNDTNNSDCCKWERVKCDLTSGRYKSFERLKNLEILDISENGVNNTVLPFINTASSLKTLILHGNNMEGTFPMKELINLRNLELLDLSKNQFVGPVPDLANFHNLQGLDMSDNKFSGSNKGLCQLKNLRELDLSQNKFTGQFPQCFDSLTQLQVLDISSNNFNGTVPSLIRNLDSVEYLALSDNEFKGFFSLELIANLSKLKVFKLSSRSNLLRLKKLSSLQPKFQLSVIELQNCNLENVPSFIQHQKDLHVINLSNNKLTGVFPYWLLEKYPNLRVLLLQNNSLTMLELPRLLNHTLQILDLSANNFDQRLPENIGKVLPNIRHLNLSNNGFQWILPSSFGEMKDIKFLDLSHNNFSGSLPMKFLIGCSSLHTLKLSYNKFFGQIFPKQTNFGSLVVLIANNNLFTGIADGLRNVQSLGVLDLSNNYLQGVIPSWFGGFFFAYLFLSNNLLEGTLPSTLFSKPTFKILDLSGNKFSGNLPSHFTGMDMSLLYLNDNEFSGTIPSTLIKDVLVLDLRNNKLSGTIPHFVKNEFILSLLLRGNTLTGHIPTDLCGLRSIRILDLANNRLKGSIPTCLNNVSFGRRLNYEVNGDKLPFEINDDEEFAVYSRLLVLPRQYSPDYTGVLMFNVEFASKSRYDSYTQESFNFMFGLDLSSNELSGDIPKELGDLQRIRALNLSHNSLSGLIPQSFSNLTDIESIDLSFNLLRGPIPQDLSKLDYMVVFNVSYNNLSGSIPSHGKFSTLDETNFIGNLLLCGSAINRSCDDNSTTEFLESDDQSGDEETTIDMEIFYWSLAATYGVTWITFIVFLCFDSPWRRVW

HMMPfam: PF08263
IPR013210
31-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERKGLLELKAYVNKEYSYDWSNDTKSDCCRWERVECD

Gene3D: G3DSA:3.80.10.10
52-302 G3DSA:3.80.10.10

SNDTKSDCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGLAVLHKLHALDLSDNTFSGSLGREGLCQLKNLQELDLSQNEFTGPFPQCFSSLTQLQVLDMSSNQFNGTLPSVISNLDSLEYLSLSDNKFEGFFSFDLIANLSKLKVF

superfamily: SSF52058
58-387 SSF52058,LRR

DCCRWERVECDRTSGRVIGLFLNQTFSDPILINLSLFHPFEELRTLNLYDFGCTGWFDDIHGYKSLGKLKKLEILDMGNNEVNNSVLPFLNAASSLRTLILHGNNMEGTFPMKELKDLSNLELLDLSGNLLNGPVPGLAVLHKLHALDLSDNTFSGSLGREGLCQLKNLQELDLSQNEFTGPFPQCFSSLTQLQVLDMSSNQFNGTLPSVISNLDSLEYLSLSDNKFEGFFSFDLIANLSKLKVFKLSSKSSLLHIESEISLQLKFRLSVIDLKYCNLEAVPSFLQQQKDLRLINLSNNKLTGISPSWFLENYPKLRVLLLWNNSFTIFH

ProfileScan: PS51450
IPR001611
128-148 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEILDMGNNEVNNSVLPFLN

ProfileScan: PS51450
IPR001611
152-173 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRTLILHGNNMEGTFPMKELK

ProfileScan: PS51450
IPR001611
177-199 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLELLDLSGNLLNGPVPGLAVLH

ProfileScan: PS51450
IPR001611
200-221 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLHALDLSDNTFSGSLGREGLC

ProfileScan: PS51450
IPR001611
225-246 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQELDLSQNEFTGPFPQCFSS

HMMPfam: PF13855
225-283 LRR_8,Leucine rich repeat

NLQELDLSQNEFTGPFPQCFSSLTQLQVLDMSSNQFNGTLPSVISNLDSLEYLSLSDNK

ProfileScan: PS51450
IPR001611
249-271 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQVLDMSSNQFNGTLPSVISNL

ProfileScan: PS51450
IPR001611
273-294 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLSDNKFEGFFSFDLIA

Gene3D: G3DSA:3.80.10.10
303-561 G3DSA:3.80.10.10

KLSSKSSLLHIESEISLQLKFRLSVIDLKYCNLEAVPSFLQQQKDLRLINLSNNKLTGISPSWFLENYPKLRVLLLWNNSFTIFHLPRLLVHSLHVLDLSVNKFDEWLPNNIGHVLPNISHLNLSNNGFQGNLPSSFSEMKKIFFLDLSHNNLSGSLPKKFCIGCSSLSILKLSYNRFSGKIFPQPMKLESLRVLIADNNQFTEITDVLIHSKGLVFLELSNNSLQGVIPSWFGGFYFLYLSVSDNLLNGTIPSTLFNV

HMMPfam: PF13855
324-382 LRR_8,Leucine rich repeat

RLSVIDLKYCNLEAVPSFLQQQKDLRLINLSNNKLTGISPSWFLENYPKLRVLLLWNNS

superfamily: SSF52058
324-578 SSF52058,LRR

RLSVIDLKYCNLEAVPSFLQQQKDLRLINLSNNKLTGISPSWFLENYPKLRVLLLWNNSFTIFHLPRLLVHSLHVLDLSVNKFDEWLPNNIGHVLPNISHLNLSNNGFQGNLPSSFSEMKKIFFLDLSHNNLSGSLPKKFCIGCSSLSILKLSYNRFSGKIFPQPMKLESLRVLIADNNQFTEITDVLIHSKGLVFLELSNNSLQGVIPSWFGGFYFLYLSVSDNLLNGTIPSTLFNVSFQLLDLSRNKFSGNLP

ProfileScan: PS51450
IPR001611
347-368 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRLINLSNNKLTGISPSWFLE

ProfileScan: PS51450
IPR001611
372-392 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLLLWNNSFTIFHLPRLL

ProfileScan: PS51450
IPR001611
395-417 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLHVLDLSVNKFDEWLPNNIGHV

HMMPfam: PF00560
IPR001611
420-441 LRR_1
Leucine-rich repeat

NISHLNLSNNGFQGNLPSSFSE

ProfileScan: PS51450
IPR001611
420-442 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NISHLNLSNNGFQGNLPSSFSEM

ProfileScan: PS51450
IPR001611
444-466 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KIFFLDLSHNNLSGSLPKKFCIG

ProfileScan: PS51450
IPR001611
493-514 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVLIADNNQFTEITDVLIHS

ProfileScan: PS51450
IPR001611
516-537 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLVFLELSNNSLQGVIPSWFGG

Gene3D: G3DSA:3.80.10.10
564-681 G3DSA:3.80.10.10

QLLDLSRNKFSGNLPSHFSFRHMGLLYLHDNEFSGPVPSTLLENVMLLDLRNNKLSGTIPRFVSNRYFLYLLLRGNALTGHIPTSLCELKSIRVLDLANNRLNGSIPPCLNNVSFGRS

superfamily: SSF52058
581-863 SSF52058,LRR

FSFRHMGLLYLHDNEFSGPVPSTLLENVMLLDLRNNKLSGTIPRFVSNRYFLYLLLRGNALTGHIPTSLCELKSIRVLDLANNRLNGSIPPCLNNVSFGRSLDYEIDPDFGSSYGMVRADQELEESYSRSLVLPLEFELDYSGYLDFTVEFASKRRYDSYMGESFKFMFGLDFSSNELIGEIPRELGDFQRIRALNLSHNSLSGLVPESFSNLTDIESIDLSFNVLHGPIPHDLTKLDYIVVFNVSYNNLSGLIPSQGKFLSLDVTNYIGNPFLCGTTINKSC

ProfileScan: PS51450
IPR001611
607-629 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NVMLLDLRNNKLSGTIPRFVSNR

ProfileScan: PS51450
IPR001611
654-676 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIRVLDLANNRLNGSIPPCLNNV

HMMPfam: PF00560
IPR001611
654-673 LRR_1
Leucine-rich repeat

SIRVLDLANNRLNGSIPPCL

Gene3D: G3DSA:3.80.10.10
751-857 G3DSA:3.80.10.10

LDFSSNELIGEIPRELGDFQRIRALNLSHNSLSGLVPESFSNLTDIESIDLSFNVLHGPIPHDLTKLDYIVVFNVSYNNLSGLIPSQGKFLSLDVTNYIGNPFLCGT

HMMPfam: PF13855
751-805 LRR_8,Leucine rich repeat

LDFSSNELIGEIPRELGDFQRIRALNLSHNSLSGLVPESFSNLTDIESIDLSFNV

ProfileScan: PS51450
IPR001611
771-792 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RIRALNLSHNSLSGLVPESFSN

HMMPfam: PF08263
IPR013210
930-969 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SERKGLLELKAYLNISEYPYDWPNDTNNSDCCKWERVKCD

superfamily: SSF52047
973-1285 SSF52047,LRR

GRYKSFERLKNLEILDISENGVNNTVLPFINTASSLKTLILHGNNMEGTFPMKELINLRNLELLDLSKNQFVGPVPDLANFHNLQGLDMSDNKFSGSNKGLCQLKNLRELDLSQNKFTGQFPQCFDSLTQLQVLDISSNNFNGTVPSLIRNLDSVEYLALSDNEFKGFFSLELIANLSKLKVFKLSSRSNLLRLKKLSSLQPKFQLSVIELQNCNLENVPSFIQHQKDLHVINLSNNKLTGVFPYWLLEKYPNLRVLLLQNNSLTMLELPRLLNHTLQILDLSANNFDQRLPENIGKVLPNIRHLNLSNNGFQ

Gene3D: G3DSA:3.80.10.10
979-1257 G3DSA:3.80.10.10

ERLKNLEILDISENGVNNTVLPFINTASSLKTLILHGNNMEGTFPMKELINLRNLELLDLSKNQFVGPVPDLANFHNLQGLDMSDNKFSGSNKGLCQLKNLRELDLSQNKFTGQFPQCFDSLTQLQVLDISSNNFNGTVPSLIRNLDSVEYLALSDNEFKGFFSLELIANLSKLKVFKLSSRSNLLRLKKLSSLQPKFQLSVIELQNCNLENVPSFIQHQKDLHVINLSNNKLTGVFPYWLLEKYPNLRVLLLQNNSLTMLELPRLLNHTLQILDLSAN

ProfileScan: PS51450
IPR001611
983-1003 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDISENGVNNTVLPFIN

ProfileScan: PS51450
IPR001611
1007-1028 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLILHGNNMEGTFPMKELI

ProfileScan: PS51450
IPR001611
1032-1054 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLELLDLSKNQFVGPVPDLANFH

ProfileScan: PS51450
IPR001611
1055-1077 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQGLDMSDNKFSGSNKGLCQLK

HMMPfam: PF13855
1078-1136 LRR_8,Leucine rich repeat

NLRELDLSQNKFTGQFPQCFDSLTQLQVLDISSNNFNGTVPSLIRNLDSVEYLALSDNE

ProfileScan: PS51450
IPR001611
1078-1101 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRELDLSQNKFTGQFPQCFDSLT

ProfileScan: PS51450
IPR001611
1102-1124 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQVLDISSNNFNGTVPSLIRNL

ProfileScan: PS51450
IPR001611
1126-1147 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SVEYLALSDNEFKGFFSLELIA

ProfileScan: PS51450
IPR001611
1177-1198 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLSVIELQNCNLENVPSFIQHQ

HMMPfam: PF13855
1177-1236 LRR_8,Leucine rich repeat

QLSVIELQNCNLENVPSFIQHQKDLHVINLSNNKLTGVFPYWLLEKYPNLRVLLLQNNSL

ProfileScan: PS51450
IPR001611
1200-1221 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLHVINLSNNKLTGVFPYWLLE

ProfileScan: PS51450
IPR001611
1225-1246 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRVLLLQNNSLTMLELPRLLN

ProfileScan: PS51450
IPR001611
1248-1270 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLQILDLSANNFDQRLPENIGKV

Gene3D: G3DSA:3.80.10.10
1258-1385 G3DSA:3.80.10.10

NFDQRLPENIGKVLPNIRHLNLSNNGFQWILPSSFGEMKDIKFLDLSHNNFSGSLPMKFLIGCSSLHTLKLSYNKFFGQIFPKQTNFGSLVVLIANNNLFTGIADGLRNVQSLGVLDLSNNYLQGVIP

HMMPfam: PF13855
1272-1332 LRR_8,Leucine rich repeat

PNIRHLNLSNNGFQWILPSSFGEMKDIKFLDLSHNNFSGSLPMKFLIGCSSLHTLKLSYNK

ProfileScan: PS51450
IPR001611
1273-1294 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIRHLNLSNNGFQWILPSSFGE

superfamily: SSF52047
1287-1729 SSF52047,LRR

ILPSSFGEMKDIKFLDLSHNNFSGSLPMKFLIGCSSLHTLKLSYNKFFGQIFPKQTNFGSLVVLIANNNLFTGIADGLRNVQSLGVLDLSNNYLQGVIPSWFGGFFFAYLFLSNNLLEGTLPSTLFSKPTFKILDLSGNKFSGNLPSHFTGMDMSLLYLNDNEFSGTIPSTLIKDVLVLDLRNNKLSGTIPHFVKNEFILSLLLRGNTLTGHIPTDLCGLRSIRILDLANNRLKGSIPTCLNNVSFGRRLNYEVNGDKLPFEINDDEEFAVYSRLLVLPRQYSPDYTGVLMFNVEFASKSRYDSYTQESFNFMFGLDLSSNELSGDIPKELGDLQRIRALNLSHNSLSGLIPQSFSNLTDIESIDLSFNLLRGPIPQDLSKLDYMVVFNVSYNNLSGSIPSHGKFSTLDETNFIGNLLLCGSAINRSCDDNSTTEFLESDDQS

ProfileScan: PS51450
IPR001611
1297-1318 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIKFLDLSHNNFSGSLPMKFLI

ProfileScan: PS51450
IPR001611
1369-1390 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLGVLDLSNNYLQGVIPSWFGG

HMMPfam: PF00560
IPR001611
1370-1390 LRR_1
Leucine-rich repeat

LGVLDLSNNYLQGVIPSWFGG

Gene3D: G3DSA:3.80.10.10
1396-1535 G3DSA:3.80.10.10

LFLSNNLLEGTLPSTLFSKPTFKILDLSGNKFSGNLPSHFTGMDMSLLYLNDNEFSGTIPSTLIKDVLVLDLRNNKLSGTIPHFVKNEFILSLLLRGNTLTGHIPTDLCGLRSIRILDLANNRLKGSIPTCLNNVSFGRR

HMMPfam: PF00560
IPR001611
1418-1437 LRR_1
Leucine-rich repeat

KILDLSGNKFSGNLPSHFTG

ProfileScan: PS51450
IPR001611
1461-1483 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DVLVLDLRNNKLSGTIPHFVKNE

ProfileScan: PS51450
IPR001611
1508-1530 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIRILDLANNRLKGSIPTCLNNV

HMMPfam: PF13855
1602-1657 LRR_8,Leucine rich repeat

LDLSSNELSGDIPKELGDLQRIRALNLSHNSLSGLIPQSFSNLTDIESIDLSFNLL

Gene3D: G3DSA:3.80.10.10
1602-1707 G3DSA:3.80.10.10

LDLSSNELSGDIPKELGDLQRIRALNLSHNSLSGLIPQSFSNLTDIESIDLSFNLLRGPIPQDLSKLDYMVVFNVSYNNLSGSIPSHGKFSTLDETNFIGNLLLCG

ProfileScan: PS51450
IPR001611
1622-1643 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RIRALNLSHNSLSGLIPQSFSN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox