PRGDB00050658 (T1E4.9)

From PRG Wiki
Jump to: navigation, search
T1E4.9
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 10998935 (AC069299)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T1E4 genomic sequence, complete sequence.

DNA Sequence

GTGCTATTATCTTTCTCCGGTGTTTTCGTTCCACCGGAGCTGCCACGTGTGATCCTGATGACGAAGCGGGTCTTTTAGGTTTCAAATCGGGTATAACCAAAGATCCTTCGGGCATTCTCAGCTCATGGAAGAAAGGTACTGACTGCTGCTTTTGGAGCGGTGTCTTTTGCGTCAACAACGACCGCGTCACACAACTAAGTGTGGATGGAGACTTTTCTCTTGACGGAAACTCTCCCTCCGGCACTATCTCGCCGATGCTGGCCAAACTTCAACACCTCGAGAGGATTCTTCTCACCTCTCTTCGAAAGATTACTGGTCCTTTTCCTCAATTCATTTTCCGATTACCAAAGCTAAATTACATAAACATCCAAGGTTGCCTTCTCTCTGGTCCCCTTCCAGCCAACATCGGCGAGCTAAGTCAATTGAAAACTTTAGTTATCGACGGAAACATGTTCACGGGTCATATTCCAAGTTCGATAGCCAATTTGACTCGGTTAACTTGGCTTAACCTCGGCAACAACCGCCTCTCTGGCACCATTCCAAACATATTTAAATCCATGAAAGAGCTCAATTCTCTTGATCTCTCCCGCAACGGATTTTTCGGGAGACTTCCTCCGTCGATTGCTTCGCTTGCACCAACTCTCTATTACCTCGATCTGAGCCAGAACAATCTCTCGGGGACGATCCCAAACTATTTATCAAGGTTTGAGGCGCTCTCCACATTGGTACTCTCGAAGAATAAGTACTCGGGGGTCGTGCCAATGAGTTTCACCAATCTGATCAACATTACCAATCTTGATCTCTCCCACAATCTTCTAACTGGTCCATTCCCTGTATTGAAAAGCATTAACGGCATTGAATCTCTGGATTTGTCGTACAACAAGTTTCACCTGAAAACGATTCCAAAATGGATGATATCGTCACCATCCATCTACTCATTGAAGTTGGCAAAATGTGGGCTGAAGATAAGCTTAGATGATTGGAAGCTAGCAGGGACCTACTACTATGATTCCATCGATCTGTCTGAAAACGAGATCTCAGGGAGTCCGGCTAAGTTCCTCAGCCAGAYGAAGTATCTGATGGAGTTCCGAGCGGCAGGGAACAAACTCCGATTCGATTTGGGGAAGCTGACGTTTGTGAGGACTCTTGAAACCTTGGATTTGTCAAGGAACTTGATATTCGGGAGAGTGCTGGCAACATTTGCTGGACTGAAGACAATGAACGTGAGTCAAAACCATCTTTGCGGAAAACTTCCGGTGACAAAGTTCCCGGCCAGTGYGTTTGCGGGTAACGACTGTCTTTGTGGCTCTCCACTTTCTCCTTGTAAAGTGTAGATGAATTCACTCTCCTTCACTCTCTTCATATTTTCTGTCATTACCTTTCTACAATGTTTAAGTTCAACCGGAGCTGCCACGTGTCATCCTGATGACGAGGCGGGTCTTTTAGCTTTCAAATCCGGTATAACACAAGATCCTTCGGGCATGCTCAGCTCTTGGAAGAAGGGTACTTCTTGCTGCTCGTGGAAAGGTATCATTTGCTTTAACAGTGACCGCGTCACCATGCTTGAACTAGTAGGATTTCCCAAAAAACCCGAACGTTCCCTCTCCGGCACTCTCTCACCGTCGCTAGCCAAACTCCAGCACCTAAGCGTGATTAGCTTAGGAGGTCATGTGAACATCACTGGATCTTTTCCTAAGTTCCTTCTCCAATTACCAAAGCTAAGGTACGTTGACATCCAAAATAACCGTCTCTCCGGTCCACTTCCGGCTAACATCGGCGTGCTAAGCTTGTTGGAAGAAATCTTTCTTCAAGGAAATAAGTTCACCGGTCCCATCCCGAACTCGATATCGAATCTAACTCGATTATCTTATCTCATTTTTGGCGGTAATCTCCTAACCGGGACTATACCCTTAGGGATTGCTAATCTCAAGCTCATGCAGAATCTGCAACTCGGCGACAACCGCCTCTCTGGCACCATCCCGGATATTTTCGAATCCATGAAGTTGCTCAAATTTCTCGATCTCTCCAGCAACGAATTCTACGGGAAACTTCCTCTATCGATTGCTACACTGGCACCGACACTCCTGGCCCTCCAAGTGAGCCAGAACAATCTCTCTGGGGCGATCCCAAACTATATATCAAGATTCAACAAGCTTGAAAAGTTAGATCTCTCCAAGAACCGGTTCTCGGGGGTTGTGCCTCAAGGTTTCGTCAATCTCACCAATATTAACAATCTTGATCTCTCTCACAATCTTCTAACCGGTCAATTTCCTGACTTGACCGTCAACACTATCGAATATCTTGATCTCTCTTACAACCAATTTCAACTAGAAACGATTCCACAATGGGTGACCTTGTTGCCGAGCGTCTTCTTGTTGAAGCTAGCAAAATGCGGGATCAAGATGAGCTTAGATGATTGGAAGCCAGCGGAACCGTTGTACTACCATTACATTGATTTGTCGAAAAACGAGATCTCAGGGAGTCTAGAAAGGTTCTTGAACGAGACGAGGTATCTGCTTGAGTTTCGGGCGGCGGAGAACAAACTTCGATTCGATATGGGGAACCTAACGTTTCCGAGGACACTAAAAACTTTGGATCTGTCAAGGAACTTGGTATTTGGTAAGGTGCCTGTCACGGTGGCTGGTCTACAAAGACTAAACTTAAGTCAAAACCATCTTTGTGGAGAACTTCCTACGACAAAGTTCCCGGCTAGCGCCTTCGCCG


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Arabidopsis thaliana].

MNSLSFTLFIFSVITFLQCLSSTGAATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPTTKFPASAFAGAIIFLRCFRSTGAATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQXKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCKV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-907 PTHR24420,FAMILY NOT NAMED

MNSLSFTLFIFSVITFLQCLSSTGAATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPTTKFPASAFAGAIIFLRCFRSTGAATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQXKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCKV

HMMPanther: PTHR24420:SF509
1-907 PTHR24420:SF509

MNSLSFTLFIFSVITFLQCLSSTGAATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPTTKFPASAFAGAIIFLRCFRSTGAATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQXKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCKV

superfamily: SSF52058
26-365 SSF52058,LRR

ATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPA

Gene3D: G3DSA:3.80.10.10
27-246 G3DSA:3.80.10.10

TCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATL

HMMPfam: PF08263
IPR013210
30-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIIC

Gene3D: G3DSA:3.80.10.10
248-454 G3DSA:3.80.10.10

PTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPT

HMMPfam: PF13855
250-308 LRR_8,Leucine rich repeat

LLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLL

superfamily: SSF52058
319-453 SSF52058,LRR

TIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELP

HMMPfam: PF00560
IPR001611
438-457 LRR_1
Leucine-rich repeat

LQRLNLSQNHLCGELPTTKF

superfamily: SSF52058
478-794 SSF52058,LRR

ATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLA

Gene3D: G3DSA:3.80.10.10
479-773 G3DSA:3.80.10.10

TCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPS

HMMPfam: PF08263
IPR013210
482-520 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFC

HMMPfam: PF13855
603-661 LRR_8,Leucine rich repeat

SQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRN

HMMPfam: PF13855
676-736 LRR_8,Leucine rich repeat

PTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLL

Gene3D: G3DSA:3.80.10.10
774-881 G3DSA:3.80.10.10

IYSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQXKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKL

superfamily: SSF52058
801-906 SSF52058,LRR

SIDLSENEISGSPAKFLSQXKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox