PRGDB00050666 (F2K11.26)

From PRG Wiki
Jump to: navigation, search
F2K11.26
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6623889 (AC008047)
Gene Class CNL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Genomic sequence for Arabidopsis thaliana BAC F2K11 from chromosome I, complete sequence.

DNA Sequence

ATGGGTATTTCTTTCTCGATACCCTTTGATCCGTGTGTAAATAAAGTCTCTCAATGGCTAGACATGAAAGTAAGTTATACTCACAATCTCGAGAAGAATCTCGCAGCTTTGGAGAAAACCATGAAAGAGCTCAAGGCTAAGCGGGATGATTTGGAAAGAAGGCTCAAAAGAGAGGAGGCTAGAGGTCTACAAAGGCTTTCCGAATTCCAGGTATGGCTTGATAGTGTTGCGACTGTCGAAGACATAATCATTACTCTTCTTAGAGATAGAAATGTTGAAATTCAAAGGCTGTGTCTTTGCCGGTTTTGCTCTAAGAGTTTAACGAGGAGCTATCGTTATGGGAAAAGTGTTTTCTTGAGGTTGAGGGAGGTTGAGAAACTCAAAGGTGAAGTTTTTGGAGTGATAACCGAGCAAGCTTCAACATCTGCGTTTGAGGAACGACCTCTTCAACCGACAATCGTTGGTCAAGACACAATGCTCGATAAGGCAGGGAAACATCTCATGGAAGATGGAGTTGGTATTATGGGTATGTACGGTATGGGCGGTGTAGGGAAGACAACACTTCTCACTCAGCTCTACAATATGTTCAATAAGGATAAGTGTGGATTTGATATTGGCATTTGGGTTGTCGTGTCTCAAGAGTTTCATGTGGAGAAGGTTCAAGATGAAATCGCTCAAAAGCTTGGTCTTGGTGGAGATGAGTGGACACAGAAAGATAAAAGTCAAAAGGGGATTTGTTTATACAATATCTTGAGGGAAAAGAGTTTTGTGTTGTTTTTAGATGACATATGGGAAAAGGTGGATTTAGCTGAGATCGGAGTTCCGGATCCAAGAACCAAAAAAGGACGTAAATTGGCATTTACGACTCGGTCCCAAGAGGTATGTGCACGCATGGGGGTCGAACATCCAATGGAAGTCCAATGCTTGGAAGAGAATGTGGCATTTGATTTGTTCCAAAAGAAGGTTGGACAAACAACACTTGGAAGCGATCCGGGGATCCCCCAACTTGCAAGAATAGTTGCGAAAAAATGTTGTGGCCTACCATTGGCGCTCAACGTCATAGGCGAGACCATGTCATGCAAAAGGACGATACAAGAATGGCGTCACGCTATACATGTTTTGAATTCATACGCTGCAGAGTTTATAGGCATGGAGGATAAGGTTCTTCCGCTTTTGAAGTATAGCTACGATAACCTTAAGGGGGAGCAAGTCAAATCGAGTTTGTTGTATTGTGCTTTATATCCAGAAGATGCGAAAATTCTGAAAGAAGATTTGATAGAGCATTGGATATGCGAGGAAATTATAGATGGAAGTGAAGGTATAGAAAAGGCTGAGGACAAGGGTTATGAGATTATAGGTTGTCTTGTTCGCGCATCATTGTTGATGGAGTGGGATGATGGGGATGGACGACGTGCTGTGTGTATGCATGACGTTGTTCGTGAAATGGCCTTATGGATCGCTTCTGAACTGGGAATACAAAAGGAGGCCTTCATTGTGCGTGCAGGTGTTGGCGTACGTGAAATTCCAAAGATTAAGAATTGGAATGTTGTGAGAAGGATGTCATTGATGGAGAACAAGATTCATCATCTCGTTGGTAGTTATGAATGTATGGAACTCACAACTTTGCTCCTGGGAAAGCGAGAATATGGAAGTATTCGGAGTCAATTAAAAACGATCTCGAGTGAATTCTTCAATTGCATGCCAAAGCTAGCTGTTTTGGATCTATCGCATAATAAAAGTCTCTTTGAATTGCCGGAAGAAATATCAAATCTAGTTTCCTTGAAATATCTCAACTTGTTATATACTGAGATAAGTCATTTGCCTAAGGGTATACAAGAGTTGAAGAAAATAATTCACTTGAATTTGGAGTATACAAGGAAGCTTGAGAGCATTACTGGGATATCAAGTCTGCATAACTTGAAAGTTCTGAAATTATTTCGTTCTAGATTACCATGGGATCTCAACACAGTGAAGGAGCTGGAAACTTTGGAACATTTAGAAATTTTAACCACAACTATCGATCCAAGAGCGAAGCAGTTTTTGAGCTCCCATAGGTTGCTGAGTCATTCACGATTGCTAGAGATCTATGGATCTTCTGTATCCTCACTAAATAGACATCTAGAATCACTTTCAGTATCTACGGACAAGCTTCGCGAATTTCAAATTAAGAGCTGCAGTATCTCTGAGATTAAGATGGGAGGGATATGCAACTTCTTGAGCCTCGTCGATGTGAATATATTCAATTGTGAAGGCTTGAGGGAATTGACGTTTCTGATCTTTGCTCCAAAGATTAGATCTCTTTCTGTTTGGCATGCAAAAGACCTAGAAGATATAATAAACGAAGAGAAAGCTTGTGAAGGTGAAGAATCGGGGATTCTTCCTTTTCCAGAGCTGAATTTTCTTACTTTACATGATCTACCGAAGCTGAAGAAGATCTATTGGAGACCTCTACCCTTTCTATGTCTAGAAGAAATCAATATAAGGGAATGTCCAAATCTGAGAAAGCTTCCACTCGATTCCACAAGTGGCAAGCAAGGTGAAAATGGATGCATCATACGTAACAAAGATTCACGTTGGTTTGAAGGTGTGAAATGGGCAGACGAAGCTACGAAAAAACGCTTCTTACCTTCATGCCAATTGATTTCTCTTAAATGA


Protein sequences

Name Description Sequence
F2K11.26 F2K11.26 [Arabidopsis thaliana].

MGISFSIPFDPCVNKVSQWLDMKVSYTHNLEKNLAALEKTMKELKAKRDDLERRLKREEARGLQRLSEFQVWLDSVATVEDIIITLLRDRNVEIQRLCLCRFCSKSLTRSYRYGKSVFLRLREVEKLKGEVFGVITEQASTSAFEERPLQPTIVGQDTMLDKAGKHLMEDGVGIMGMYGMGGVGKTTLLTQLYNMFNKDKCGFDIGIWVVVSQEFHVEKVQDEIAQKLGLGGDEWTQKDKSQKGICLYNILREKSFVLFLDDIWEKVDLAEIGVPDPRTKKGRKLAFTTRSQEVCARMGVEHPMEVQCLEENVAFDLFQKKVGQTTLGSDPGIPQLARIVAKKCCGLPLALNVIGETMSCKRTIQEWRHAIHVLNSYAAEFIGMEDKVLPLLKYSYDNLKGEQVKSSLLYCALYPEDAKILKEDLIEHWICEEIIDGSEGIEKAEDKGYEIIGCLVRASLLMEWDDGDGRRAVCMHDVVREMALWIASELGIQKEAFIVRAGVGVREIPKIKNWNVVRRMSLMENKIHHLVGSYECMELTTLLLGKREYGSIRSQLKTISSEFFNCMPKLAVLDLSHNKSLFELPEEISNLVSLKYLNLLYTEISHLPKGIQELKKIIHLNLEYTRKLESITGISSLHNLKVLKLFRSRLPWDLNTVKELETLEHLEILTTTIDPRAKQFLSSHRLLSHSRLLEIYGSSVSSLNRHLESLSVSTDKLREFQIKSCSISEIKMGGICNFLSLVDVNIFNCEGLRELTFLIFAPKIRSLSVWHAKDLEDIINEEKACEGEESGILPFPELNFLTLHDLPKLKKIYWRPLPFLCLEEINIRECPNLRKLPLDSTSGKQGENGCIIRNKDSRWFEGVKWADEATKKRFLPSCQLISLK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
5-881 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FSIPFDPCVNKVSQWLDMKVSYTHNLEKNLAALEKTMKELKAKRDDLERRLKREEARGLQRLSEFQVWLDSVATVEDIIITLLRDRNVEIQRLCLCRFCSKSLTRSYRYGKSVFLRLREVEKLKGEVFGVITEQASTSAFEERPLQPTIVGQDTMLDKAGKHLMEDGVGIMGMYGMGGVGKTTLLTQLYNMFNKDKCGFDIGIWVVVSQEFHVEKVQDEIAQKLGLGGDEWTQKDKSQKGICLYNILREKSFVLFLDDIWEKVDLAEIGVPDPRTKKGRKLAFTTRSQEVCARMGVEHPMEVQCLEENVAFDLFQKKVGQTTLGSDPGIPQLARIVAKKCCGLPLALNVIGETMSCKRTIQEWRHAIHVLNSYAAEFIGMEDKVLPLLKYSYDNLKGEQVKSSLLYCALYPEDAKILKEDLIEHWICEEIIDGSEGIEKAEDKGYEIIGCLVRASLLMEWDDGDGRRAVCMHDVVREMALWIASELGIQKEAFIVRAGVGVREIPKIKNWNVVRRMSLMENKIHHLVGSYECMELTTLLLGKREYGSIRSQLKTISSEFFNCMPKLAVLDLSHNKSLFELPEEISNLVSLKYLNLLYTEISHLPKGIQELKKIIHLNLEYTRKLESITGISSLHNLKVLKLFRSRLPWDLNTVKELETLEHLEILTTTIDPRAKQFLSSHRLLSHSRLLEIYGSSVSSLNRHLESLSVSTDKLREFQIKSCSISEIKMGGICNFLSLVDVNIFNCEGLRELTFLIFAPKIRSLSVWHAKDLEDIINEEKACEGEESGILPFPELNFLTLHDLPKLKKIYWRPLPFLCLEEINIRECPNLRKLPLDSTSGKQGENGCIIRNKDSRWFEGVKWADEATKKRFLPSCQLI

HMMPanther: PTHR23155:SF110
5-881 PTHR23155:SF110,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

FSIPFDPCVNKVSQWLDMKVSYTHNLEKNLAALEKTMKELKAKRDDLERRLKREEARGLQRLSEFQVWLDSVATVEDIIITLLRDRNVEIQRLCLCRFCSKSLTRSYRYGKSVFLRLREVEKLKGEVFGVITEQASTSAFEERPLQPTIVGQDTMLDKAGKHLMEDGVGIMGMYGMGGVGKTTLLTQLYNMFNKDKCGFDIGIWVVVSQEFHVEKVQDEIAQKLGLGGDEWTQKDKSQKGICLYNILREKSFVLFLDDIWEKVDLAEIGVPDPRTKKGRKLAFTTRSQEVCARMGVEHPMEVQCLEENVAFDLFQKKVGQTTLGSDPGIPQLARIVAKKCCGLPLALNVIGETMSCKRTIQEWRHAIHVLNSYAAEFIGMEDKVLPLLKYSYDNLKGEQVKSSLLYCALYPEDAKILKEDLIEHWICEEIIDGSEGIEKAEDKGYEIIGCLVRASLLMEWDDGDGRRAVCMHDVVREMALWIASELGIQKEAFIVRAGVGVREIPKIKNWNVVRRMSLMENKIHHLVGSYECMELTTLLLGKREYGSIRSQLKTISSEFFNCMPKLAVLDLSHNKSLFELPEEISNLVSLKYLNLLYTEISHLPKGIQELKKIIHLNLEYTRKLESITGISSLHNLKVLKLFRSRLPWDLNTVKELETLEHLEILTTTIDPRAKQFLSSHRLLSHSRLLEIYGSSVSSLNRHLESLSVSTDKLREFQIKSCSISEIKMGGICNFLSLVDVNIFNCEGLRELTFLIFAPKIRSLSVWHAKDLEDIINEEKACEGEESGILPFPELNFLTLHDLPKLKKIYWRPLPFLCLEEINIRECPNLRKLPLDSTSGKQGENGCIIRNKDSRWFEGVKWADEATKKRFLPSCQLI

superfamily: SSF52540
136-382 SSF52540

TEQASTSAFEERPLQPTIVGQDTMLDKAGKHLMEDGVGIMGMYGMGGVGKTTLLTQLYNMFNKDKCGFDIGIWVVVSQEFHVEKVQDEIAQKLGLGGDEWTQKDKSQKGICLYNILREKSFVLFLDDIWEKVDLAEIGVPDPRTKKGRKLAFTTRSQEVCARMGVEHPMEVQCLEENVAFDLFQKKVGQTTLGSDPGIPQLARIVAKKCCGLPLALNVIGETMSCKRTIQEWRHAIHVLNSYAAEFI

HMMPfam: PF00931
IPR002182
157-436 NB-ARC,NBS
NB-ARC

DTMLDKAGKHLMEDGVGIMGMYGMGGVGKTTLLTQLYNMFNKDKCGFDIGIWVVVSQEFHVEKVQDEIAQKLGLGGDEWTQKDKSQKGICLYNILREKSFVLFLDDIWEKVDLAEIGVPDPRTKKGRKLAFTTRSQEVCARMGVEHPMEVQCLEENVAFDLFQKKVGQTTLGSDPGIPQLARIVAKKCCGLPLALNVIGETMSCKRTIQEWRHAIHVLNSYAAEFIGMEDKVLPLLKYSYDNLKGEQVKSSLLYCALYPEDAKILKEDLIEHWICEEIID

Gene3D: G3DSA:3.40.50.300
170-265 G3DSA:3.40.50.300

DGVGIMGMYGMGGVGKTTLLTQLYNMFNKDKCGFDIGIWVVVSQEFHVEKVQDEIAQKLGLGGDEWTQKDKSQKGICLYNILREKSFVLFLDDIWE

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

IMGMYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

ILREKSFVLFLDDIW

FPrintScan: PR00364
IPR000767
344-358 DISEASERSIST
Disease resistance protein

CCGLPLALNVIGETM

superfamily: SSF52058
474-837 SSF52058,LRR

CMHDVVREMALWIASELGIQKEAFIVRAGVGVREIPKIKNWNVVRRMSLMENKIHHLVGSYECMELTTLLLGKREYGSIRSQLKTISSEFFNCMPKLAVLDLSHNKSLFELPEEISNLVSLKYLNLLYTEISHLPKGIQELKKIIHLNLEYTRKLESITGISSLHNLKVLKLFRSRLPWDLNTVKELETLEHLEILTTTIDPRAKQFLSSHRLLSHSRLLEIYGSSVSSLNRHLESLSVSTDKLREFQIKSCSISEIKMGGICNFLSLVDVNIFNCEGLRELTFLIFAPKIRSLSVWHAKDLEDIINEEKACEGEESGILPFPELNFLTLHDLPKLKKIYWRPLPFLCLEEINIRECPNLRKLP

Gene3D: G3DSA:3.80.10.10
506-669 G3DSA:3.80.10.10

REIPKIKNWNVVRRMSLMENKIHHLVGSYECMELTTLLLGKREYGSIRSQLKTISSEFFNCMPKLAVLDLSHNKSLFELPEEISNLVSLKYLNLLYTEISHLPKGIQELKKIIHLNLEYTRKLESITGISSLHNLKVLKLFRSRLPWDLNTVKELETLEHLEIL

FPrintScan: PR00364
IPR000767
565-581 DISEASERSIST
Disease resistance protein

NCMPKLAVLDLSHNKSL

Gene3D: G3DSA:3.80.10.10
688-838 G3DSA:3.80.10.10

SHSRLLEIYGSSVSSLNRHLESLSVSTDKLREFQIKSCSISEIKMGGICNFLSLVDVNIFNCEGLRELTFLIFAPKIRSLSVWHAKDLEDIINEEKACEGEESGILPFPELNFLTLHDLPKLKKIYWRPLPFLCLEEINIRECPNLRKLPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox