PRGDB00050691 (resistance protein CAN_RGA1)

From PRG Wiki
Jump to: navigation, search
resistance protein CAN_RGA1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 33302328 (AY270158)
Gene Class NL
Domain Type LRR, LRR, NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum resistance protein CAN_RGA1 gene, partial cds.

DNA Sequence

ATGGCACCATGTCGGGTGAGCGCATCCACGGGAGCAGTGGGTTCCCTCCTGACAAAGTTGGGAACCATGCTAGATGACGAATACAAGCTGCTCGCGGGTTTTGGTCGAGACATCGAGATCGTCATACATGAGCTTGCTATCTGGCAATCATTTCTCCTCAAGGTGGCGGACACGGAGGAACCTGAACGGTTTGACAAGAGTCTTGCTGACTTTGTGCGGGAGCTGTCATATGATATTGAGGACAAGATTGACAACTGGATGCCACTTATGCTCCATCACGTCTATTCCAACAGTGGCTGCAAGAAGCACATGAGCAAATTCAAGAACTTGTTACCTGTCAAGATCCCGTATCAGATAGCCAAAGATATAAAAGACATCAAGAGCCAAATCTTGGATGTCGGTAATAGATGTGAAAGATACAGGGGTGGTAATAGATTTGAAAGATATATGGTTGACTATGTCTGTCCCGCAAGAACAGAATATGTTGACCCTAGATTGTGCACAGTCGATACATGTGCAGCCGACCTTGTAGGCATTGATGGTCCGAAATATGAGCTTGTTAAGTGGCTGAGAAACGGGGAGGATGAACAGAAGGTTGTCTCTATTGTTGGTTGTGCGGGTTTAGGGAAGACGACTCTTGCCAAACAGGTCTACGACGAGCTTAGAATAAACTTTCAATATCGGGCTTTTGTATCAATTTCACGAAGCCCTGATATGGCAACCATTTTAAAATGTGTACTGTCTCAATTCCACGCTCAAGATTATTCTTCCGATGAAAGCGAGATTCCAAAACTCGTCGATCAAATCAGAGATCTCCTACAAGATAAAAGGTACTTTGTGATAATCGATGATATATGGGATATGAAGACATGGGATGTTTTGAAATGTGCGTTATGCAAGAATAGTTGTGGCAGTGTAATAATGACCACAACACGTATTTATGATGTAGCTAAATCATGTTGCTCTTCTAACGGGGATCTTGTCTACAATATCCAACCACTTAGTGTTGCTGACTCGGAGAAGCTATTTTTGAACCGAGTATTTGGTCACGAAAAGGAATTTCCCCCTGAATTGAAAGAAGTCTCGAAGGATGTCTTAAGAAAATGTGGTGGTTTACCACTGGCCATCAATGCCATATCTAGATTGCTGGCTGCTGAGGAAAACAAAGAAGAGTGGGGTCACGTGGGACTCTCTAGTTTCTTTGTACGAGGAGAAAAATCTGACATTGATGCTATGAAATACATATTATCTCTGAGTTACTTTGACCTTCCCCCTGATCTAAGAAGTTGTCTATTGTATTTGGCTATGTTTCCCGAAGATTGTTTGATTGAAAAGGAGCGGTTAGTACACAGATGGATTTCAGAGGGCTTCATTCGCAATGAAGATGGGGAAGATCTTGTTGAAGTAGGAGAGAGATATTTATATGAGCTTGTTAACAGAAGTTTAATAGAATCAGTGGGCGTGCCATATGATGGTAAGGCACGGTTCTACAGAGTCCACAATGTTATCCTTGATTTCCTCATGATAAAGTCCATGGAAGAGAATTTTTGTACTTTGACAAGTAATCAATCAAGGCTAGATTACAAAGTACGTCGTCTCTCTCTGTTTGCAAACAAAGATCCATCATGTATCGCACAACTGGATTTATCGCATGCTCGATCTCTCGGTGCTTCTGGGCATCTTGGGCAATTAATTTCCTCTGTGAAGTCAAATGCTCTGCGTGTGCTCGACGTACAAGATTGCTCGGAGTTGGGGAATCATCATGTCAAAGATATTGGAAGGAATCCTCTATTAAGGTACTTGAACATCTCTGGAACAGATGTAACTGAGCTTCCCATACAGATTGGAGATATGGGGTTCCTAGAAACACTTGATGCATCATTTACGGAATTAGTTGAGATGCCTGGATCCATTACTCGTCTAAGACAACTGCAGCGTCTGTTTGTTTCAGATGAAACTAAATTGCCTGATGAGATTGGAAATATGAAGAGGTTGCAAGAGCTTGGTGATATAAATGCCTTCAAGCAATCCGTTAACTTTCTGAATGAGCTGGGCAAATTAACGGGTTTGCGTAAGCTGGGAATTATTTGGGACACCAATGATATTCTTAAATCTGGCAAGGGAAGTTCCAAGGAAAAAAGGTTGGTGTCCTCCCTCTCTAAACTGGATGCAGGCAGACTTAGCAACCTCTATGTTACATTTTATTTGAGAGAAAAGGATGGCTTCATAGGACATCCGTTCTTGCCTGCTCTCAATAGCATCCGAGAGGTCTATCTCCGCCGTGGACGCATGTGTTGGATGAACAAATGGCTGCTTTCACTTGCCAACCTAGAAAAATTATATATCAGTGGTGGGGATGAGATAGAGCAAGATGATCTGCGTACAGTTGGAAGCATACCAACTCTGGTTGAATTCAAGCTTTACTCTGGATGCTTAGGGCCTATCATCATAAGTTCAGGATTTGAACAGTTAGAGAGGCTCGAGTTGAAGTTCAGTTTTTCGCAGCTGACGTTTGAAGTGGGCGCTATGCCTAACCTGAAGAAACTTGATCTCCATGTTTATTTATCTAAGTTCAAATCTGTTGGCGCTGGTTTTGATTTTGGCATCCAGCATCTCTCCAGCCTTGCTTGCGTTTCTATCGTCATATTTTGCGAGGGCGTCAGTGCTGCCTATGTGGAGGCAGCGGAGGGAGCTTTCAAGAGCATG


Protein sequences

Name Description Sequence
resistance protein CAN_RGA1 resistance protein CAN_RGA1 [Triticum aestivum].

MAPCRVSASTGAVGSLLTKLGTMLDDEYKLLAGFGRDIEIVIHELAIWQSFLLKVADTEEPERFDKSLADFVRELSYDIEDKIDNWMPLMLHHVYSNSGCKKHMSKFKNLLPVKIPYQIAKDIKDIKSQILDVGNRCERYRGGNRFERYMVDYVCPARTEYVDPRLCTVDTCAADLVGIDGPKYELVKWLRNGEDEQKVVSIVGCAGLGKTTLAKQVYDELRINFQYRAFVSISRSPDMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEKLFLNRVFGHEKEFPPELKEVSKDVLRKCGGLPLAINAISRLLAAEENKEEWGHVGLSSFFVRGEKSDIDAMKYILSLSYFDLPPDLRSCLLYLAMFPEDCLIEKERLVHRWISEGFIRNEDGEDLVEVGERYLYELVNRSLIESVGVPYDGKARFYRVHNVILDFLMIKSMEENFCTLTSNQSRLDYKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGIIWDTNDILKSGKGSSKEKRLVSSLSKLDAGRLSNLYVTFYLREKDGFIGHPFLPALNSIREVYLRRGRMCWMNKWLLSLANLEKLYISGGDEIEQDDLRTVGSIPTLVEFKLYSGCLGPIIISSGFEQLERLELKFSFSQLTFEVGAMPNLKKLDLHVYLSKFKSVGAGFDFGIQHLSSLACVSIVIFCEGVSAAYVEAAEGAFKSM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
25-695 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DDEYKLLAGFGRDIEIVIHELAIWQSFLLKVADTEEPERFDKSLADFVRELSYDIEDKIDNWMPLMLHHVYSNSGCKKHMSKFKNLLPVKIPYQIAKDIKDIKSQILDVGNRCERYRGGNRFERYMVDYVCPARTEYVDPRLCTVDTCAADLVGIDGPKYELVKWLRNGEDEQKVVSIVGCAGLGKTTLAKQVYDELRINFQYRAFVSISRSPDMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEKLFLNRVFGHEKEFPPELKEVSKDVLRKCGGLPLAINAISRLLAAEENKEEWGHVGLSSFFVRGEKSDIDAMKYILSLSYFDLPPDLRSCLLYLAMFPEDCLIEKERLVHRWISEGFIRNEDGEDLVEVGERYLYELVNRSLIESVGVPYDGKARFYRVHNVILDFLMIKSMEENFCTLTSNQSRLDYKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGI

HMMPanther: PTHR11017:SF126
25-695 PTHR11017:SF126,OS11G0237600 PROTEIN

DDEYKLLAGFGRDIEIVIHELAIWQSFLLKVADTEEPERFDKSLADFVRELSYDIEDKIDNWMPLMLHHVYSNSGCKKHMSKFKNLLPVKIPYQIAKDIKDIKSQILDVGNRCERYRGGNRFERYMVDYVCPARTEYVDPRLCTVDTCAADLVGIDGPKYELVKWLRNGEDEQKVVSIVGCAGLGKTTLAKQVYDELRINFQYRAFVSISRSPDMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEKLFLNRVFGHEKEFPPELKEVSKDVLRKCGGLPLAINAISRLLAAEENKEEWGHVGLSSFFVRGEKSDIDAMKYILSLSYFDLPPDLRSCLLYLAMFPEDCLIEKERLVHRWISEGFIRNEDGEDLVEVGERYLYELVNRSLIESVGVPYDGKARFYRVHNVILDFLMIKSMEENFCTLTSNQSRLDYKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGI

superfamily: SSF52540
159-398 SSF52540

TEYVDPRLCTVDTCAADLVGIDGPKYELVKWLRNGEDEQKVVSIVGCAGLGKTTLAKQVYDELRINFQYRAFVSISRSPDMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEKLFLNRVFGHEKEFPPELKEVSKDVLRKCGGLPLAINAISRLLAAEENKEEWGHVGLS

Gene3D: G3DSA:3.40.50.300
174-289 G3DSA:3.40.50.300

ADLVGIDGPKYELVKWLRNGEDEQKVVSIVGCAGLGKTTLAKQVYDELRINFQYRAFVSISRSPDMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMK

HMMPfam: PF00931
IPR002182
184-462 NB-ARC,NBS
NB-ARC

YELVKWLRNGEDEQKVVSIVGCAGLGKTTLAKQVYDELRINFQYRAFVSISRSPDMATILKCVLSQFHAQDYSSDESEIPKLVDQIRDLLQDKRYFVIIDDIWDMKTWDVLKCALCKNSCGSVIMTTTRIYDVAKSCCSSNGDLVYNIQPLSVADSEKLFLNRVFGHEKEFPPELKEVSKDVLRKCGGLPLAINAISRLLAAEENKEEWGHVGLSSFFVRGEKSDIDAMKYILSLSYFDLPPDLRSCLLYLAMFPEDCLIEKERLVHRWISEGFIRNED

FPrintScan: PR00364
IPR000767
199-214 DISEASERSIST
Disease resistance protein

VVSIVGCAGLGKTTLA

FPrintScan: PR00364
IPR000767
272-286 DISEASERSIST
Disease resistance protein

LLQDKRYFVIIDDIW

FPrintScan: PR00364
IPR000767
369-383 DISEASERSIST
Disease resistance protein

CGGLPLAINAISRLL

superfamily: SSF52047
528-852 SSF52047,LRR

YKVRRLSLFANKDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGIIWDTNDILKSGKGSSKEKRLVSSLSKLDAGRLSNLYVTFYLREKDGFIGHPFLPALNSIREVYLRRGRMCWMNKWLLSLANLEKLYISGGDEIEQDDLRTVGSIPTLVEFKLYSGCLGPIIISSGFEQLERLELKFSFSQLTFEVGAMPNLKKLDLH

Gene3D: G3DSA:3.80.10.10
539-696 G3DSA:3.80.10.10

KDPSCIAQLDLSHARSLGASGHLGQLISSVKSNALRVLDVQDCSELGNHHVKDIGRNPLLRYLNISGTDVTELPIQIGDMGFLETLDASFTELVEMPGSITRLRQLQRLFVSDETKLPDEIGNMKRLQELGDINAFKQSVNFLNELGKLTGLRKLGII

FPrintScan: PR00364
IPR000767
568-584 DISEASERSIST
Disease resistance protein

VKSNALRVLDVQDCSEL

Gene3D: G3DSA:3.80.10.10
766-851 G3DSA:3.80.10.10

WMNKWLLSLANLEKLYISGGDEIEQDDLRTVGSIPTLVEFKLYSGCLGPIIISSGFEQLERLELKFSFSQLTFEVGAMPNLKKLDL


List of References

Catherine Feuillet, Silvia Travella, Nils Stein, Laurence Albar, Aurélie Nublat, Beat Keller
Map-based isolation of the leaf rust disease resistance gene Lr10 from the hexaploid wheat (Triticum aestivum L.) genome.
Proc. Natl. Acad. Sci. U.S.A.: 2003, 100(25);15253-8
PubMed:14645721 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox